Synbio Technologies는 혁신적인 합성 생물학 솔루션을 제공하여 생명과학 연구 및 개발을 지원하는 기업입니다.
카탈로그 제품 리스트
| Product ID | Product Name (60 max characters) | Short Description for web display | Target species | Host species | Product type |
| SOC-A1585 | CpG ODN 1585 | Class A CpG ODN, Mouse-preferred. TLR9 Agonist. | Mouse | N/A | Oligonucleotide |
| SOC-A2216 | CpG ODN 2216 | Class A CpG ODN, Human-preferred. TLR9 Agonist. | Human | N/A | Oligonucleotide |
| SOC-A2336 | CpG ODN 2336 | Class A CpG ODN, Human-preferred. TLR9 Agonist. | Human | N/A | Oligonucleotide |
| SOC-B1668 | CpG ODN 1668 | Class B CpG ODN, Mouse-preferred. TLR9 Agonist. | Mouse | N/A | Oligonucleotide |
| SOC-B1826 | CpG ODN 1826 | Class B CpG ODN, Mouse-preferred. TLR9 Agonist. | Mouse | N/A | Oligonucleotide |
| SOC-B2006 | CpG ODN 2006/7909 | Class B CpG ODN, Human-preferred. TLR9 Agonist. | Human | N/A | Oligonucleotide |
| SOC-B2007 | CpG ODN 2007 | Class B CpG ODN, Bovine/Porcine. TLR9 Agonist. | Bovine/Porcine | N/A | Oligonucleotide |
| SOC-BW006 | CpG ODN BW006/684 | Class B CpG ODN, Human/Mouse. TLR9 Agonist. | Human/Mouse | N/A | Oligonucleotide |
| SOC-BDSL01 | CpG ODN D-SL01 | Class B CpG ODN, Multispecies. TLR9 Agonist. | Multispecies | N/A | Oligonucleotide |
| SOC-C2395 | CpG ODN 2395 | Class C CpG ODN, Human/Mouse. TLR9 Agonist. | Human/Mouse | N/A | Oligonucleotide |
| SOC-CM362 | CpG ODN M362 | Class C CpG ODN, Human/Mouse. TLR9 Agonist. | Human/Mouse | N/A | Oligonucleotide |
| SOC-CDSL03 | CpG ODN D-SL03 | Class C CpG ODN, Multispecies. TLR9 Agonist. | Multispecies | N/A | Oligonucleotide |
| SOC-10101 | CpG ODN 10101 | CpG ODN, Human/Mouse. TLR9 Agonist. | Human/Mouse | N/A | Oligonucleotide |
| SOC-IMT504 | CpG ODN IMT504 | Non-CpG ODN, Human/Mouse. | Human/Mouse | N/A | Oligonucleotide |
| SOC-1982 | CpG ODN 1982 | Non-CpG ODN, Human/Mouse. R-848 inhibitor. Can be used as control for B-class CpG ODNs. | Human/Mouse | N/A | Oligonucleotide |
| SOC-2088 | CpG ODN 2088 | Inhibitory ODN, Human/Mouse. TLR9 Antagonist. | Human/Mouse | N/A | Oligonucleotide |
| SOC-21158 | CpG ODN 21158 | Inhibitory ODN, Human/Mouse. TLR9 Antagonist. | Human/Mouse | N/A | Oligonucleotide |
| SOC-4084-F | CpG ODN 4084-F | Class B Inhibitory ODN, Human/Mouse. TLR9 Antagonist. | Human/Mouse | N/A | Oligonucleotide |
| SOC-5328 | CpG ODN 5328 | Non-CpG ODN, Human/Mouse. Can be used as control for Class C 2395 CpG ODN. | Human/Mouse | N/A | Oligonucleotide |
| SOC-BW001 | CpG ODN BW001 | Class C CpG ODN, Human/Mouse. | Human/Mouse | N/A | Oligonucleotide |
| SOC-INH-1 | CpG ODN INH-1 | Inhibitory ODN, Human/Mouse. TLR9 Antagonist. | Human/Mouse | N/A | Oligonucleotide |
| SOC-M326 | CpG ODN M326 | CpG ODN, Human/Mouse. TLR9 Agonist. | Human/Mouse | N/A | Oligonucleotide |
| SOC-TTAGGG | CpG ODN TTAGGG | ODN TTAGGG (A151). Human/Mouse. TLR9, AIM2, cGAS Antagonist | Human/Mouse | N/A | Oligonucleotide |
| HX-mRNA007 | mRNA-mCherry- Renilla Luciferase | mRNA-mCherry-Renilla Luciferase is a ready-to-use dual-reporter mRNA product that integrates red luorescent protein (mCherry) with Renilla luciferase (RLuc). It is suitable for applications such as mRNA expression studies, cell transfection experiments, reporter gene assays. | N/A | N/A | mRNA |
| HX-mRNA008 | mRNA-OVA | mRNA-OVA is a ready-to-use mRNA product encoding ovalbumin (OVA), suitable for immunological studies, antigen expression validation, mRNA vaccine development, and T cell activation assays. | N/A | N/A | mRNA |
| HX-mRNA009 | mRNA-EPO | mRNA-EPO is a ready-to-use mRNA product encoding human erythropoietin (EPO), designed for applications in hematology research, anemia model studies, mRNA drug development, and protein expression analysis. | N/A | N/A | mRNA |
| HX-mRNA011 | mRNA-d2EGFP | mRNA-d2EGFP is a ready-to-use mRNA product encoding destabilized enhanced green luorescent protein (d2EGFP), specifically designed for real-time luorescence detection, studies of mRNA translation kinetics, short-term protein expression analysis, and mRNA delivery research. | N/A | N/A | mRNA |
| HX-mRNA018 | mRNA-Cre | mRNA-Cre is a ready-to-use mRNA product encoding Cre recombinase, designed for applications involving the Cre-loxP system, including gene editing, in vitro transfection experiments, mRNA delivery studies, and gene knockout research in cell and animal models. | N/A | N/A | mRNA |
| HX-mRNA019 | mRNA-mScarlet3 | mRNA-mScarlet3 is a ready-to-use mRNA product encoding the mScarlet3 red luorescent protein. It is suitable for mRNA delivery research, luorescence tracing experiments, protein expression studies, and cell transfection assays. | N/A | N/A | mRNA |
| HX-mRNA020 | mRNA-mStayGold | mRNA-mStayGold is a ready-to-use mRNA product encoding the mStayGold ultra-high photostability luorescent protein. It is suitable for luorescence tracing experiments, long-term live-cell imaging, mRNA delivery research, and protein expression analysis. | N/A | N/A | mRNA |
| HX-mRNA021 | mRNA-Gaussia Luciferase | mRNA-Gaussia Luciferase (mRNA-GLuc) is a ready-to-use mRNA product encoding Gaussia luciferase (GLuc). It is suitable for in vitro transcription (IVT) assays, mRNA delivery studies, reporter gene detection, in vivo monitoring of secreted luciferase, and high-throughput screening experiments. | N/A | N/A | mRNA |
| HX-mRNA012 | mRNA-EGFP | mRNA-eGFP is a ready-to-use mRNA product encoding enhanced green fluorescent protein (eGFP). It is suitable for in vitro experiments and transfection in mammalian cells. | N/A | N/A | mRNA |
| HX-mRNA013 | mRNA-Firefly Luciferase | mRNA-Firefly Luciferase is a ready-to-use mRNA product encoding firefly luciferase, which generates a bioluminescent signal (peak emission at ~560 nm) through the oxidation of the substrate D-luciferin. | N/A | N/A | mRNA |
| HX-mRNA014 | mRNA-mCherry | mRNA-mCherry is a ready-to-use mRNA product encoding the red fluorescent protein mCherry, which has an excitation wavelength of 587 nm and an emission wavelength of 610 nm. | N/A | N/A | mRNA |
| HX-mRNA023 | mRNA-eGFP-Firefly Luciferase | The mRNA-eGFP-Firely Luciferase is a ready-to-use mRNA product that combines enhanced green luorescent protein (eGFP) with Firely Luciferase (Fluc). The open reading frame (ORF) of eGFP is derived from the jellyfish Aequorea victoria .The Fluc gene, originating from the firely Photinus pyralis. | N/A | N/A | mRNA |
| HX-mRNA024 | mRNA-CCR4 | mRNA-CCR4 is a ready-to-use mRNA product encoding C-C chemokine receptor 4 (CCR4). It is suitable for immunology research, studies on T cell homing mechanisms, mRNA delivery investigations, and tumor immunology research. | N/A | N/A | mRNA |
| HX-mRNA025 | mRNA-CD3G | mRNA-CD3G is a ready-to-use mRNA product encoding CD3G (CD3 gamma chain). It is suitable for T cell activation research, immune signaling pathway studies, mRNA delivery research, and cell therapy development. | N/A | N/A | mRNA |
| HX-mRNA026 | mRNA-CD3D | mRNA-CD3D is a ready-to-use mRNA product encoding CD3D (CD3 delta chain). It is suitable for T cell activation studies, immune signaling research, mRNA delivery investigations, and cell therapy development. | N/A | N/A | mRNA |
| HX-mRNA027 | mRNA-CD3E | mRNA-CD3E is a ready-to-use mRNA product encoding CD3E (CD3 epsilon chain). It is suitable for T cell activation research, immune signaling studies, mRNA delivery research, and cell therapy development. | N/A | N/A | mRNA |
| HX-mRNA028 | mRNA-CD247 (CD3 zeta) | mRNA-CD247 (also known as CD3Z or CD3 zeta chain) is a ready-to-use mRNA product encoding the CD3 zeta chain of the T cell receptor complex (TCR-CD3 complex). It is suitable for T cell activation research, immune signaling studies, mRNA delivery research, and cell therapy development. | N/A | N/A | mRNA |
| HX-mRNA029 | mRNA-CD5 | mRNA-CD5 is a ready-to-use mRNA product encoding the CD5 molecule. It is suitable for T cell activation studies, immune signaling regulation research, mRNA delivery investigations, as well as autoimmune and tumor immunology research. | N/A | N/A | mRNA |
| HX-mRNA030 | mRNA-CD7 | mRNA-CD7 is a ready-to-use mRNA product encoding the CD7 molecule. It is suitable for T cell activation studies, immune signaling regulation research, mRNA delivery investigations, and immunotherapy research. | N/A | N/A | mRNA |
| HX-mRNA031 | mRNA-CD19 | mRNA-CD19 is a ready-to-use mRNA product encoding the CD19 molecule. It is suitable for B cell immunology research, CAR-T cell therapy studies, mRNA delivery research, and tumor immunotherapy. | N/A | N/A | mRNA |
| HX-mRNA032 | mRNA-CD20 | mRNA-CD20 is a ready-to-use mRNA product encoding the CD20 molecule. It is suitable for B cell immunology research, CAR-T and immunotherapy studies, mRNA delivery research, and autoimmune disease research. | N/A | N/A | mRNA |
| HX-mRNA033 | mRNA-CD22 | mRNA-CD22 is a ready-to-use mRNA product encoding the CD22 molecule. It is suitable for B cell immunology research, CAR-T and immunotherapy studies, mRNA delivery research, and investigations into B cell-related diseases. | N/A | N/A | mRNA |
| HX-mRNA034 | mRNA-BCMA (TNFRSF17) | mRNA-BCMA (B Cell Maturation Antigen, TNFRSF17) is a ready-to-use mRNA product encoding the BCMA molecule. It is suitable for plasma cell immunology research, CAR-T and immunotherapy studies, mRNA delivery research, and multiple myeloma (MM) investigations. | N/A | N/A | mRNA |
| HX-mRNA041 | mRNA-TNFR1 | mRNA-TNFR1 (TNFRSF1A, Tumor Necrosis Factor Receptor 1) is a ready-to- use mRNA product encoding TNFR1. It is suitable for apoptosis research, inlammation and immune signaling pathway studies, mRNA delivery research, and autoimmune disease investigations. | N/A | N/A | mRNA |
| HX-mRNA042 | mRNA-EGFR | mRNA-EGFR is a ready-to-use mRNA product encoding the Epidermal Growth Factor Receptor (EGFR). It is suitable for cancer research, signaling pathway studies, mRNA delivery investigations, and anti-EGFR targeted therapy research. | N/A | N/A | mRNA |
| HX-mRNA043 | mRNA-HER2 (ERBB2) | mRNA-HER2 (ERBB2) is a ready-to-use mRNA product encoding Human Epidermal Growth Factor Receptor 2 (HER2/ERBB2). It is suitable for research on HER2-positive tumors such as breast cancer and gastric cancer, anti-HER2 targeted therapy studies, and mRNA delivery research. | N/A | N/A | mRNA |
| HX-mRNA047 | mRNA-MET | mRNA-MET is a ready-to-use mRNA product encoding the Hepatocyte Growth Factor Receptor (MET). It is suitable for tumor research, cancer signaling pathway studies, and anti-MET targeted therapy development. | N/A | N/A | mRNA |
| HX-mRNA053 | mRNA-DLL3 | mRNA-DLL3 (Delta-Like Ligand 3) is a ready-to-use mRNA product encoding the DLL3 protein. It is suitable for small cell lung cancer (SCLC) research, Notch signaling pathway studies, and antibody drug development. | N/A | N/A | mRNA |
| HX-mRNA058 | mRNA-Claudin 18.2 | mRNA-Claudin 18.2 is a ready-to-use mRNA product encoding the tight junction protein Claudin 18.2. It is suitable for cancer research, anti- Claudin 18.2 targeted therapy, and mRNA vaccine development. | N/A | N/A | mRNA |
| HX-mRNA059 | mRNA-GPRC5D | mRNA-GPRC5D is a ready-to-use mRNA product encoding the G protein- coupled receptor GPRC5D. It is suitable for multiple myeloma (MM) research, immunotherapy development, and targeted drug discovery. | N/A | N/A | mRNA |
| HX-mRNA064 | mRNA-PD1 (PDCD1) | mRNA-PD1 (Programmed Cell Death Protein 1, PDCD1) is a ready-to-use mRNA product encoding the PD-1 receptor. It is suitable for T cell function studies, tumor immunology research, and anti-PD-1 immunotherapy development. | N/A | N/A | mRNA |
| HX-mRNA074 | mRNA-IL2 | mRNA-IL2 (Interleukin-2) is a ready-to-use mRNA product encoding IL-2, a key T cell growth factor. It is suitable for studies on T cell proliferation, immune regulation, and cancer immunotherapy. | N/A | N/A | mRNA |
| HX-mRNA075 | mRNA-IL4 | mRNA-IL4 (Interleukin-4) is a ready-to-use mRNA product encoding IL-4, a key cytokine involved in promoting Th2 cell diferentiation. It is suitable for research on allergic diseases, Th2 cell function, and immune regulation. | N/A | N/A | mRNA |
| HX-mRNA076 | mRNA-IL5 | mRNA-IL5 (Interleukin-5) is a ready-to-use mRNA product encoding IL-5, a key cytokine involved in the regulation of eosinophil proliferation and activation. It is suitable for research on eosinophil function and allergic diseases. | N/A | N/A | mRNA |
| HX-mRNA077 | mRNA-IL6 | mRNA-IL6 (Interleukin-6) is a ready-to-use mRNA product encoding IL-6, a key cytokine involved in acute-phase responses and inlammatory signaling. It is suitable for research on chronic inlammation, cancer- related inlammation, and immune regulation. | N/A | N/A | mRNA |
| HX-mRNA078 | mRNA-IL12(αβ) | mRNA-IL12(αβ) is a ready-to-use mRNA product encoding IL-12α (p35) and IL-12β (p40) ， IL-12 is a potent immunomodulatory ，cytokine that promotes Th1 immune responses, activates NK and CD8+T cells ，and enhances IFN-γ secretion, making it highly valuable in cancer immunotherapy. | N/A | N/A | mRNA |
| HX-mRNA081 | mRNA-TNF | mRNA-TNF (Tumor Necrosis Factor, TNF-α) is a ready-to-use mRNA product encoding TNF-α, a key mediator of acute inlammatory responses. It is suitable for research on inlammation, immune regulation, and anti-tumor immunity. | N/A | N/A | mRNA |
| HX-mRNA082 | mRNA-TIGIT | mRNA-TIGIT is an in vitro transcribed (IVT) messenger RNA product that encodes the human TIGIT protein (T cell immunoreceptor with Ig and ITIM domains). TIGIT is an inhibitory immune checkpoint molecule expressed on the surface of immune cells such as T cells and natural killer (NK) cells. | N/A | N/A | mRNA |
| HX-mRNA083 | mRNA-TNFRSF8 | mRNA-TNFRSF8 is an in vitro transcribed (IVT) synthetic messenger RNA product that encodes the human TNFRSF8 protein, also known as CD30, a member of the tumor necrosis factor receptor superfamily member 8 (TNFRSF8). | N/A | N/A | mRNA |
| HX-mRNA085 | mRNA-CD79A | mRNA-CD79A is an in vitro transcribed (IVT) messenger RNA encoding the CD79A protein (also known as Igα or MB-1), a fundamental component of the B-cell receptor (BCR) complex that partners with CD79B to mediate B- cell signaling, development and antigen response. | N/A | N/A | mRNA |
| HX-mRNA086 | mRNA-CD79B | mRNA-CD79B is an in vitro transcribed (IVT) messenger RNA encoding the CD79B protein (also known as Igβ or B29), a critical component of the B- cell receptor (BCR) complex .Playing an essential role in B-cell development, antigen recognition, and immune response activation. | N/A | N/A | mRNA |
| HX-mRNA087 | mRNA-CD33 | mRNA-CD33 is an in vitro transcribed (IVT) messenger RNA encoding the CD33 protein (Siglec-3), a transmembrane receptor expressed on myeloid cells that modulates immune responses through its immunoreceptor tyrosine-based inhibitory motif (ITIM). | N/A | N/A | mRNA |
| HX-mRNA090 | mRNA-CD9 | mRNA-CD9 is an in vitro transcribed (IVT) messenger RNA encoding the CD9 protein, a member of the tetraspanin family that regulates cell adhesion, migration, and signal transduction. | N/A | N/A | mRNA |
| HX-mRNA091 | mRNA-CD63 | mRNA-CD63 is an in vitro transcribed (IVT) messenger RNA encoding the CD63 protein, a tetraspanin family member widely used as an exosome marker that plays roles in intracellular trafficking, membrane fusion, and immune cell modulation. | N/A | N/A | mRNA |
| HX-mRNA092 | mRNA-CD81 | mRNA-CD81 is an in vitro transcribed (IVT) messenger RNA encoding the CD81 protein, a key member of the tetraspanin superfamily that serves as a crucial organizer of membrane microdomains and facilitates diverse cellular processes including cell adhesion, migration, and signal transduction. | N/A | N/A | mRNA |
| HX-mRNA093 | mRNA-CD4 | mRNA-CD4 is an in vitro transcribed (IVT) messenger RNA encoding the CD4 protein, a crucial co-receptor expressed primarily on helper T cells that plays a central role in adaptive immune responses by interacting with MHC class II molecules on antigen-presenting cells. | N/A | N/A | mRNA |
| HX-mRNA099 | mRNA-CD276 | mRNA-CD276 is an in vitro transcribed (IVT) messenger RNA encoding the CD276 protein (also known as B7-H3), an immune checkpoint molecule belonging to the B7 family that modulates T cell responses through co- stimulatory and co-inhibitory signals. | N/A | N/A | mRNA |
| HX-mRNA100 | mRNA-SDC1 (CD138) | mRNA-SDC1 (CD138) is an in vitro transcribed (IVT) messenger RNA encoding the Syndecan-1 (SDC1/CD138) protein, a heparan sulfate proteoglycan that functions as a co-receptor for extracellular matrix components and growth factors. | N/A | N/A | mRNA |
| HX-mRNA111 | mRNA-CD3 (εγδζ) | mRNA-CD3(εγδζ) is a ready-to-use mRNA product encoding CD3 (CD3ε& CD3γ& CD3δ& CD3ζ). The CD3 complex is a key component of T cell receptor (TCR) signal transduction, consisting of four distinct subunits: CD3ε (epsilon), CD3γ (gamma), CD3δ (delta), and CD3ζ (zeta). | N/A | N/A | mRNA |
| HX-mRNA119 | mRNA-CD79 (αβ) | mRNA-CD79 (αβ) is an in vitro transcribed (IVT) messenger RNA co- encoding both CD79A (Igα) and CD79B (Igβ), the essential heterodimeric components of the B-cell receptor (BCR) complex. | N/A | N/A | mRNA |
| HX-mRNA145 | mRNA-CD8A | mRNA-CD8A (Cluster of Diferentiation 8 Alpha) is a ready-to-use mRNA product encoding the CD8α molecule. It is suitable for T cell immunology research and cell therapy development. | N/A | N/A | mRNA |
| HX-mRNA146 | mRNA-CD8B | mRNA-CD8B (Cluster of Diferentiation 8 Beta) is a ready-to-use mRNA product encoding the CD8β molecule. It is suitable for T cell function studies and cytotoxic immunity research. | N/A | N/A | mRNA |
| HX-mRNA147 | mRNA-CD8 (αβ) | mRNA-CD8 (αβ) is an in vitro transcribed (IVT) messenger RNA co- encoding both CD8α (CD8A) and CD8β (CD8B) chains, the heterodimeric coreceptor complex that enhances T cell antigen recognition by binding to MHC class I molecules. | N/A | N/A | mRNA |
| HX-mRNA166 | mRNA-AsCpf1 | mRNA-AsCpf1 (Acidaminococcus Cpf1) is a ready-to-use mRNA product encoding the Cpf1 nuclease (also known as Cas12a). It is suitable for gene editing research and the development of CRISPR-Cas12a systems. | N/A | N/A | mRNA |
| HX-mRNA167 | mRNA-LbCpf1 | mRNA-LbCpf1 (Lachnospiraceae Cpf1) is a ready-to-use mRNA product encoding the Cpf1 nuclease (also known as Cas12a). It is suitable for high- efficiency gene editing and functional genomics research. | N/A | N/A | mRNA |
| HX-mRNA168 | mRNA-SpCas9 | mRNA-SpCas9 (Streptococcus pyogenes Cas9) is a ready-to-use mRNA product encoding the Cas9 nuclease. It is suitable for genome editing and CRISPR-Cas9 research. SpCas9 is the most widely used gene editing tool, enabling precise gene knockout, knock-in, and gene modification. | N/A | N/A | mRNA |
| HX-mRNA169 | mRNA-eSpCas9 | mRNA-eSpCas9 is an optimized, high-fidelity Cas9 mRNA designed to minimize off-target effects and maximize editing precision. It is ideal for high-accuracy gene editing applications, particularly in therapeutic development and research demanding superior targeting specificity. | N/A | N/A | mRNA |
| HX-mRNA170 | mRNA-hyPBase | mRNA-hyPBase (Hyperactive PiggyBac Transposase) is a ready-to-use mRNA product encoding a hyperactive PiggyBac transposase. It is suitable for research in gene transposition, cellular reprogramming, and genetic modification. | N/A | N/A | mRNA |
| HX-mRNA171 | mRNA-SB100X | mRNA-SB100X (Sleeping Beauty 100X Transposase) is a ready-to-use mRNA product encoding the Sleeping Beauty transposase. It is suitable for the development of non-viral gene transfer systems and cell therapy research. | N/A | N/A | mRNA |
| HX-mRNA192 | mRNA-STEAP1 | mRNA-STEAP1 is an in vitro transcribed (IVT) messenger RNA encoding the six-transmembrane epithelial antigen of the prostate 1 (STEAP1), a metalloreductase overexpressed in prostate cancer and other solid tumors that regulates iron/copper homeostasis and promotes tumor cell proliferation. | N/A | N/A | mRNA |
| HX-mRNA199 | mRNA-CCR8 | mRNA-CCR8 is an in vitro transcribed (IVT) messenger RNA encoding the C-C chemokine receptor type 8 (CCR8), a G protein-coupled receptor that regulates immune cell migration and function through interactions with CCL1 and other chemokines. | N/A | N/A | mRNA |
| STCRI24558 | Human Gene CRISPR-KO Vector, KLF6 | CRISPR-KO vector targeting the Human KLF6 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24559 | Human Gene CRISPR-KO Vector, LEP | CRISPR-KO vector targeting the Human LEP gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24560 | Human Gene CRISPR-KO Vector, KLF7 | CRISPR-KO vector targeting the Human KLF7 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24561 | Human Gene CRISPR-KO Vector, AGT | CRISPR-KO vector targeting the Human AGT gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24562 | Human Gene CRISPR-KO Vector, EPAS1 | CRISPR-KO vector targeting the Human EPAS1 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24563 | Human Gene CRISPR-KO Vector, CISD1 | CRISPR-KO vector targeting the Human CISD1 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24564 | Human Gene CRISPR-KO Vector, HIF1A | CRISPR-KO vector targeting the Human HIF1A gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24565 | Human Gene CRISPR-KO Vector, WNT1 | CRISPR-KO vector targeting the Human WNT1 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24566 | Human Gene CRISPR-KO Vector, GATA3 | CRISPR-KO vector targeting the Human GATA3 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24567 | Human Gene CRISPR-KO Vector, LPL | CRISPR-KO vector targeting the Human LPL gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24568 | Human Gene CRISPR-KO Vector, DDIT3 | CRISPR-KO vector targeting the Human DDIT3 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24569 | Human Gene CRISPR-KO Vector, GDF10 | CRISPR-KO vector targeting the Human GDF10 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24570 | Human Gene CRISPR-KO Vector, FZD1 | CRISPR-KO vector targeting the Human FZD1 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24571 | Human Gene CRISPR-KO Vector, NAMPT | CRISPR-KO vector targeting the Human NAMPT gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24572 | Human Gene CRISPR-KO Vector, AGPAT2 | CRISPR-KO vector targeting the Human AGPAT2 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24573 | Human Gene CRISPR-KO Vector, NRIP1 | CRISPR-KO vector targeting the Human NRIP1 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24574 | Human Gene CRISPR-KO Vector, SOCS1 | CRISPR-KO vector targeting the Human SOCS1 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24575 | Human Gene CRISPR-KO Vector, NCOA1 | CRISPR-KO vector targeting the Human NCOA1 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24576 | Human Gene CRISPR-KO Vector, INS | CRISPR-KO vector targeting the Human INS gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24577 | Human Gene CRISPR-KO Vector, PPARA | CRISPR-KO vector targeting the Human PPARA gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24578 | Human Gene CRISPR-KO Vector, STAT3 | CRISPR-KO vector targeting the Human STAT3 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24579 | Human Gene CRISPR-KO Vector, NR1H3 | CRISPR-KO vector targeting the Human NR1H3 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24580 | Human Gene CRISPR-KO Vector, BMP2 | CRISPR-KO vector targeting the Human BMP2 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24581 | Human Gene CRISPR-KO Vector, CNTFR | CRISPR-KO vector targeting the Human CNTFR gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24582 | Human Gene CRISPR-KO Vector, IRS4 | CRISPR-KO vector targeting the Human IRS4 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24583 | Human Gene CRISPR-KO Vector, GH1 | CRISPR-KO vector targeting the Human GH1 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24584 | Human Gene CRISPR-KO Vector, NDN | CRISPR-KO vector targeting the Human NDN gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24585 | Human Gene CRISPR-KO Vector, ID3 | CRISPR-KO vector targeting the Human ID3 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24586 | Human Gene CRISPR-KO Vector, GLI1 | CRISPR-KO vector targeting the Human GLI1 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24587 | Human Gene CRISPR-KO Vector, DKK2 | CRISPR-KO vector targeting the Human DKK2 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24588 | Human Gene CRISPR-KO Vector, FGF19 | CRISPR-KO vector targeting the Human FGF19 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24589 | Human Gene CRISPR-KO Vector, EGF | CRISPR-KO vector targeting the Human EGF gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24590 | Human Gene CRISPR-KO Vector, GDF7 | CRISPR-KO vector targeting the Human GDF7 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24591 | Human Gene CRISPR-KO Vector, FGF21 | CRISPR-KO vector targeting the Human FGF21 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24592 | Human Gene CRISPR-KO Vector, HNF1A | CRISPR-KO vector targeting the Human HNF1A gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24593 | Human Gene CRISPR-KO Vector, ERBB3 | CRISPR-KO vector targeting the Human ERBB3 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24594 | Human Gene CRISPR-KO Vector, GATA1 | CRISPR-KO vector targeting the Human GATA1 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24595 | Human Gene CRISPR-KO Vector, SFRP4 | CRISPR-KO vector targeting the Human SFRP4 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24596 | Human Gene CRISPR-KO Vector, HDAC1 | CRISPR-KO vector targeting the Human HDAC1 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24597 | Human Gene CRISPR-KO Vector, SOX9 | CRISPR-KO vector targeting the Human SOX9 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24598 | Human Gene CRISPR-KO Vector, GDF5 | CRISPR-KO vector targeting the Human GDF5 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24599 | Human Gene CRISPR-KO Vector, APOE | CRISPR-KO vector targeting the Human APOE gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24600 | Human Gene CRISPR-KO Vector, BMP5 | CRISPR-KO vector targeting the Human BMP5 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24601 | Human Gene CRISPR-KO Vector, KIT | CRISPR-KO vector targeting the Human KIT gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24602 | Human Gene CRISPR-KO Vector, FGF10 | CRISPR-KO vector targeting the Human FGF10 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24603 | Human Gene CRISPR-KO Vector, HES1 | CRISPR-KO vector targeting the Human HES1 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24604 | Human Gene CRISPR-KO Vector, FGF4 | CRISPR-KO vector targeting the Human FGF4 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24605 | Human Gene CRISPR-KO Vector, PAX3 | CRISPR-KO vector targeting the Human PAX3 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24606 | Human Gene CRISPR-KO Vector, SMURF2 | CRISPR-KO vector targeting the Human SMURF2 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24607 | Human Gene CRISPR-KO Vector, FGF7 | CRISPR-KO vector targeting the Human FGF7 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24608 | Human Gene CRISPR-KO Vector, CD9 | CRISPR-KO vector targeting the Human CD9 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24609 | Human Gene CRISPR-KO Vector, CCN4 | CRISPR-KO vector targeting the Human CCN4 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24610 | Human Gene CRISPR-KO Vector, ATP2B2 | CRISPR-KO vector targeting the Human ATP2B2 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24611 | Human Gene CRISPR-KO Vector, ATP1B1 | CRISPR-KO vector targeting the Human ATP1B1 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24612 | Human Gene CRISPR-KO Vector, ATP10B | CRISPR-KO vector targeting the Human ATP10B gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24613 | Human Gene CRISPR-KO Vector, CFTR | CRISPR-KO vector targeting the Human CFTR gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24614 | Human Gene CRISPR-KO Vector, ABCB7 | CRISPR-KO vector targeting the Human ABCB7 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24615 | Human Gene CRISPR-KO Vector, ATP6V1E1 | CRISPR-KO vector targeting the Human ATP6V1E1 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24616 | Human Gene CRISPR-KO Vector, ATP10A | CRISPR-KO vector targeting the Human ATP10A gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24617 | Human Gene CRISPR-KO Vector, ATP13A3 | CRISPR-KO vector targeting the Human ATP13A3 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24618 | Human Gene CRISPR-KO Vector, ATP6V1A | CRISPR-KO vector targeting the Human ATP6V1A gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24619 | Human Gene CRISPR-KO Vector, ATP8A1 | CRISPR-KO vector targeting the Human ATP8A1 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24620 | Human Gene CRISPR-KO Vector, ATP6V1E2 | CRISPR-KO vector targeting the Human ATP6V1E2 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24621 | Human Gene CRISPR-KO Vector, ATP11C | CRISPR-KO vector targeting the Human ATP11C gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24622 | Human Gene CRISPR-KO Vector, ABCB8 | CRISPR-KO vector targeting the Human ABCB8 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24623 | Human Gene CRISPR-KO Vector, ATP8B4 | CRISPR-KO vector targeting the Human ATP8B4 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24624 | Human Gene CRISPR-KO Vector, ATP11A | CRISPR-KO vector targeting the Human ATP11A gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24625 | Human Gene CRISPR-KO Vector, ATP6V1C2 | CRISPR-KO vector targeting the Human ATP6V1C2 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24626 | Human Gene CRISPR-KO Vector, ATP8B3 | CRISPR-KO vector targeting the Human ATP8B3 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24627 | Human Gene CRISPR-KO Vector, ATP1A3 | CRISPR-KO vector targeting the Human ATP1A3 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24628 | Human Gene CRISPR-KO Vector, ATP6AP1 | CRISPR-KO vector targeting the Human ATP6AP1 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24629 | Human Gene CRISPR-KO Vector, ATP2C2 | CRISPR-KO vector targeting the Human ATP2C2 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24630 | Human Gene CRISPR-KO Vector, ATP1B4 | CRISPR-KO vector targeting the Human ATP1B4 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24631 | Human Gene CRISPR-KO Vector, ABCA8 | CRISPR-KO vector targeting the Human ABCA8 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24632 | Human Gene CRISPR-KO Vector, ATP2C1 | CRISPR-KO vector targeting the Human ATP2C1 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24633 | Human Gene CRISPR-KO Vector, ATP1A2 | CRISPR-KO vector targeting the Human ATP1A2 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24634 | Human Gene CRISPR-KO Vector, ATP10D | CRISPR-KO vector targeting the Human ATP10D gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24635 | Human Gene CRISPR-KO Vector, ABCA2 | CRISPR-KO vector targeting the Human ABCA2 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24636 | Human Gene CRISPR-KO Vector, ABCB5 | CRISPR-KO vector targeting the Human ABCB5 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24637 | Human Gene CRISPR-KO Vector, ABCC3 | CRISPR-KO vector targeting the Human ABCC3 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24638 | Human Gene CRISPR-KO Vector, ATP8B2 | CRISPR-KO vector targeting the Human ATP8B2 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24639 | Human Gene CRISPR-KO Vector, ATP2A2 | CRISPR-KO vector targeting the Human ATP2A2 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24640 | Human Gene CRISPR-KO Vector, ABCA3 | CRISPR-KO vector targeting the Human ABCA3 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24641 | Human Gene CRISPR-KO Vector, ATP7B | CRISPR-KO vector targeting the Human ATP7B gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24642 | Human Gene CRISPR-KO Vector, FXYD2 | CRISPR-KO vector targeting the Human FXYD2 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24643 | Human Gene CRISPR-KO Vector, ATP9A | CRISPR-KO vector targeting the Human ATP9A gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24644 | Human Gene CRISPR-KO Vector, ATP7A | CRISPR-KO vector targeting the Human ATP7A gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24645 | Human Gene CRISPR-KO Vector, ABCB11 | CRISPR-KO vector targeting the Human ABCB11 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24646 | Human Gene CRISPR-KO Vector, ATP6V0E2 | CRISPR-KO vector targeting the Human ATP6V0E2 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24647 | Human Gene CRISPR-KO Vector, ATP6V1B2 | CRISPR-KO vector targeting the Human ATP6V1B2 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24648 | Human Gene CRISPR-KO Vector, ABCC12 | CRISPR-KO vector targeting the Human ABCC12 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24649 | Human Gene CRISPR-KO Vector, ATP6V0E1 | CRISPR-KO vector targeting the Human ATP6V0E1 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24650 | Human Gene CRISPR-KO Vector, ABCC9 | CRISPR-KO vector targeting the Human ABCC9 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24651 | Human Gene CRISPR-KO Vector, ABCC2 | CRISPR-KO vector targeting the Human ABCC2 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24652 | Human Gene CRISPR-KO Vector, ATP2A1 | CRISPR-KO vector targeting the Human ATP2A1 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24653 | Human Gene CRISPR-KO Vector, ATP13A1 | CRISPR-KO vector targeting the Human ATP13A1 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24654 | Human Gene CRISPR-KO Vector, ATP1A1 | CRISPR-KO vector targeting the Human ATP1A1 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24655 | Human Gene CRISPR-KO Vector, ABCG2 | CRISPR-KO vector targeting the Human ABCG2 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24656 | Human Gene CRISPR-KO Vector, DST | CRISPR-KO vector targeting the Human DST gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24657 | Human Gene CRISPR-KO Vector, ABCA4 | CRISPR-KO vector targeting the Human ABCA4 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24658 | Human Gene CRISPR-KO Vector, ATP5F1D | CRISPR-KO vector targeting the Human ATP5F1D gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24659 | Human Gene CRISPR-KO Vector, ABCB6 | CRISPR-KO vector targeting the Human ABCB6 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24660 | Human Gene CRISPR-KO Vector, ABCB9 | CRISPR-KO vector targeting the Human ABCB9 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24661 | Human Gene CRISPR-KO Vector, ATP5F1E | CRISPR-KO vector targeting the Human ATP5F1E gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24662 | Human Gene CRISPR-KO Vector, ATP4B | CRISPR-KO vector targeting the Human ATP4B gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24663 | Human Gene CRISPR-KO Vector, IKBKB | CRISPR-KO vector targeting the Human IKBKB gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24664 | Human Gene CRISPR-KO Vector, MYC | CRISPR-KO vector targeting the Human MYC gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24665 | Human Gene CRISPR-KO Vector, CCND1 | CRISPR-KO vector targeting the Human CCND1 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24666 | Human Gene CRISPR-KO Vector, EIF4EBP1 | CRISPR-KO vector targeting the Human EIF4EBP1 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24667 | Human Gene CRISPR-KO Vector, CEBPA | CRISPR-KO vector targeting the Human CEBPA gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24668 | Human Gene CRISPR-KO Vector, PIK3CG | CRISPR-KO vector targeting the Human PIK3CG gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24669 | Human Gene CRISPR-KO Vector, GRB2 | CRISPR-KO vector targeting the Human GRB2 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24670 | Human Gene CRISPR-KO Vector, ARAF | CRISPR-KO vector targeting the Human ARAF gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24671 | Human Gene CRISPR-KO Vector, PML | CRISPR-KO vector targeting the Human PML gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24672 | Human Gene CRISPR-KO Vector, MAP2K1 | CRISPR-KO vector targeting the Human MAP2K1 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24673 | Human Gene CRISPR-KO Vector, RPS6KB1 | CRISPR-KO vector targeting the Human RPS6KB1 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24674 | Human Gene CRISPR-KO Vector, AKT1 | CRISPR-KO vector targeting the Human AKT1 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24675 | Human Gene CRISPR-KO Vector, IKBKG | CRISPR-KO vector targeting the Human IKBKG gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24676 | Human Gene CRISPR-KO Vector, KIT | CRISPR-KO vector targeting the Human KIT gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24677 | Human Gene CRISPR-KO Vector, JUP | CRISPR-KO vector targeting the Human JUP gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24678 | Human Gene CRISPR-KO Vector, ZBTB16 | CRISPR-KO vector targeting the Human ZBTB16 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24679 | Human Gene CRISPR-KO Vector, CCNA1 | CRISPR-KO vector targeting the Human CCNA1 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24680 | Human Gene CRISPR-KO Vector, MTOR | CRISPR-KO vector targeting the Human MTOR gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24681 | Human Gene CRISPR-KO Vector, BRAF | CRISPR-KO vector targeting the Human BRAF gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24682 | Human Gene CRISPR-KO Vector, RUNX1 | CRISPR-KO vector targeting the Human RUNX1 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24683 | Human Gene CRISPR-KO Vector, NRAS | CRISPR-KO vector targeting the Human NRAS gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24684 | Human Gene CRISPR-KO Vector, MAPK3 | CRISPR-KO vector targeting the Human MAPK3 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24685 | Human Gene CRISPR-KO Vector, STAT3 | CRISPR-KO vector targeting the Human STAT3 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24686 | Human Gene CRISPR-KO Vector, BAD | CRISPR-KO vector targeting the Human BAD gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24687 | Human Gene CRISPR-KO Vector, PIK3R3 | CRISPR-KO vector targeting the Human PIK3R3 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24688 | Human Gene CRISPR-KO Vector, PPARD | CRISPR-KO vector targeting the Human PPARD gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24689 | Human Gene CRISPR-KO Vector, RAF1 | CRISPR-KO vector targeting the Human RAF1 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24690 | Human Gene CRISPR-KO Vector, RPS6KB2 | CRISPR-KO vector targeting the Human RPS6KB2 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24691 | Human Gene CRISPR-KO Vector, SPI1 | CRISPR-KO vector targeting the Human SPI1 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24692 | Human Gene CRISPR-KO Vector, RELA | CRISPR-KO vector targeting the Human RELA gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24693 | Human Gene CRISPR-KO Vector, HRAS | CRISPR-KO vector targeting the Human HRAS gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24694 | Human Gene CRISPR-KO Vector, KLF5 | CRISPR-KO vector targeting the Human KLF5 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24695 | Human Gene CRISPR-KO Vector, SPOCK1 | CRISPR-KO vector targeting the Human SPOCK1 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24696 | Human Gene CRISPR-KO Vector, HNF1A | CRISPR-KO vector targeting the Human HNF1A gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24697 | Human Gene CRISPR-KO Vector, SFRP4 | CRISPR-KO vector targeting the Human SFRP4 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24698 | Human Gene CRISPR-KO Vector, BMP1 | CRISPR-KO vector targeting the Human BMP1 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24699 | Human Gene CRISPR-KO Vector, LIPE | CRISPR-KO vector targeting the Human LIPE gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24700 | Human Gene CRISPR-KO Vector, E2F1 | CRISPR-KO vector targeting the Human E2F1 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24701 | Human Gene CRISPR-KO Vector, RORA | CRISPR-KO vector targeting the Human RORA gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24702 | Human Gene CRISPR-KO Vector, E2F4 | CRISPR-KO vector targeting the Human E2F4 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24703 | Human Gene CRISPR-KO Vector, MEF2A | CRISPR-KO vector targeting the Human MEF2A gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24704 | Human Gene CRISPR-KO Vector, CYP26A1 | CRISPR-KO vector targeting the Human CYP26A1 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24705 | Human Gene CRISPR-KO Vector, FRZB | CRISPR-KO vector targeting the Human FRZB gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24706 | Human Gene CRISPR-KO Vector, SOX2 | CRISPR-KO vector targeting the Human SOX2 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24707 | Human Gene CRISPR-KO Vector, CD34 | CRISPR-KO vector targeting the Human CD34 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24708 | Human Gene CRISPR-KO Vector, WNT1 | CRISPR-KO vector targeting the Human WNT1 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24709 | Human Gene CRISPR-KO Vector, IGFBP2 | CRISPR-KO vector targeting the Human IGFBP2 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24710 | Human Gene CRISPR-KO Vector, BMP2 | CRISPR-KO vector targeting the Human BMP2 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24711 | Human Gene CRISPR-KO Vector, DLL1 | CRISPR-KO vector targeting the Human DLL1 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24712 | Human Gene CRISPR-KO Vector, ATP13A2 | CRISPR-KO vector targeting the Human ATP13A2 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24713 | Human Gene CRISPR-KO Vector, MEF2D | CRISPR-KO vector targeting the Human MEF2D gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24714 | Human Gene CRISPR-KO Vector, MIF | CRISPR-KO vector targeting the Human MIF gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24715 | Human Gene CRISPR-KO Vector, ABCC6 | CRISPR-KO vector targeting the Human ABCC6 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24716 | Human Gene CRISPR-KO Vector, TAPBP | CRISPR-KO vector targeting the Human TAPBP gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24717 | Human Gene CRISPR-KO Vector, PCK2 | CRISPR-KO vector targeting the Human PCK2 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24718 | Human Gene CRISPR-KO Vector, CFD | CRISPR-KO vector targeting the Human CFD gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24719 | Human Gene CRISPR-KO Vector, GATA4 | CRISPR-KO vector targeting the Human GATA4 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24720 | Human Gene CRISPR-KO Vector, ATP8A2 | CRISPR-KO vector targeting the Human ATP8A2 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24721 | Human Gene CRISPR-KO Vector, TAPBP | CRISPR-KO vector targeting the Human TAPBP gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24722 | Human Gene CRISPR-KO Vector, PIM2 | CRISPR-KO vector targeting the Human PIM2 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24723 | Human Gene CRISPR-KO Vector, AKT3 | CRISPR-KO vector targeting the Human AKT3 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24724 | Human Gene CRISPR-KO Vector, TAP2 | CRISPR-KO vector targeting the Human TAP2 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24725 | Human Gene CRISPR-KO Vector, ATP6V1G2 | CRISPR-KO vector targeting the Human ATP6V1G2 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24726 | Human Gene CRISPR-KO Vector, POU5F1 | CRISPR-KO vector targeting the Human POU5F1 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24727 | Human Gene CRISPR-KO Vector, TAP2 | CRISPR-KO vector targeting the Human TAP2 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24728 | Human Gene CRISPR-KO Vector, TNF | CRISPR-KO vector targeting the Human TNF gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24729 | Human Gene CRISPR-KO Vector, TAP1 | CRISPR-KO vector targeting the Human TAP1 gene. 3 different sgRNAs individually cloned into the LentiCRISPR-v2 vector (lentiviral vector expressing Cas9 under the EF1ɑ promoter, with Puro, Bleo and Amp resistance genes). | Human | E. coli, Human cells | Plasmid |
| STCRI24401 | CRISPR U6:sgRNA-EF-1a:Cas9-P2A-Puro vector backbone | High-throughput Gene Editing Vector Backbone-Mammal, CRISPR KO Vector (All-in-oneSystem) (U6:sgRNA-EF-1a:Cas9-P2A-Puro) | Mammal | E. coli, Mammalian cells | Plasmid |
| STCRI24402 | CRISPR U6 :sgRNA-EF-1a:Cas9-P2A-EGFP vector backbone | High-throughput Gene Editing Vector Backbone-Mammal, CRISPR KO Vector (All-in-one System) (U6 :sgRNA-EF-1a:Cas9-P2A-EGFP) | Mammal | E. coli, Mammalian cells | Plasmid |
| STCRI24403 | CRISPR U6:sgRNA-EF1a:Cas9-P2A-mCherry-Puro vector backbone | High-throughput Gene Editing Vector Backbone-Mammal, CRISPR KO Vector (All-in-one System) (U6:sgRNA-EF1a:Cas9-P2A-mCherry-Puro) | Mammal | E. coli, Mammalian cells | Plasmid |
| STCRI24404 | EF-1a:Cas9-P2A-Blast vector backbone | High-throughput Gene Editing Vector Backbone-Mammal, Cas9 Vector (Double-Vector System 1) (EF-1a:Cas9-P2A-Blast) | Mammal | E. coli, Mammalian cells | Plasmid |
| STCRI24405 | Tight TRE promoter:Cas9-hPGK promoter:Blast vector backbone | High-throughput Gene Editing Vector Backbone-Mammal, Cas9 Vector (Double-Vector System 1, Inducible expression Vector) (Tight TRE promoter:Cas9-hPGK promoter:Blast) | Mammal | E. coli, Mammalian cells | Plasmid |
| STCRI24406 | U6:sgRNA-EF-1a:Puro vector backbone | High-throughput Gene Editing Vector Backbone-Mammal, sgRNA Vector (Double-Vector System 2) (U6:sgRNA-EF-1a:Puro) | Mammal | E. coli, Mammalian cells | Plasmid |
| STCRI24407 | EF1a:DsRed-Monomer-U6:sgRNA vector backbone | High-throughput Gene Editing Vector Backbone-Mammal, sgRNA Vector (Double-Vector System 2) (EF1a:DsRed-Monomer-U6:sgRNA) | Mammal | E. coli, Mammalian cells | Plasmid |
| STCRI24408 | U6:sgRNA-EF-1a:Puro-P2A-EGFP vector backbone | High-throughput Gene Editing Vector Backbone-Mammal, sgRNA Vector (Double-Vector System 2) (U6:sgRNA-EF-1a:Puro-P2A-EGFP) | Mammal | E. coli, Mammalian cells | Plasmid |
| STCRI24409 | U6:sgRNA-EF-1a:Puro vector backbone, single-cell screening | High-throughput Gene Editing Vector Backbone-Mammal, sgRNA Vector (Double-Vector System 2, Single cell screening) (U6:sgRNA-EF-1a:Puro) | Mammal | E. coli, Mammalian cells | Plasmid |
| STCRI24410 | CRISPR CMV:SaCas9-U6:Sa-gRNA scaffold vector backbone | High-throughput Gene Editing Vector Backbone-Mammal, CRISPR KO Vector (All-in-one System) (CMV:SaCas9-U6:Sa-gRNA scaffold) | Mammal | E. coli, Mammalian cells | Plasmid |
| STCRI24411 | CRISPR CMV:SaCas9-T2A-mCherry-U6:Sa-gRNA scaffold vector backbone | High-throughput Gene Editing Vector Backbone-Mammal, CRISPR KO Vector (All-in-one System) (CMV:SaCas9-T2A-mCherry-U6:Sa-gRNA scaffold) | Mammal | E. coli, Mammalian cells | Plasmid |
| STCRI24412 | CRISPR U6:sgRNA-U6:sgRNA-CBh:Cas9 vector backbone | High-throughput Gene Editing Vector Backbone-Mammal, Dual-sgRNA CRISPR KO Vector (All-in-one System) (U6:sgRNA-U6:sgRNA-CBh:Cas9) | Mammal | E. coli, Mammalian cells | Plasmid |
| STCRI24413 | Dual sgRNA U6:sgRNA-U6:sgRNA-CBh:Cas9 vector backbone | High-throughput Gene Editing Vector Backbone-Mammal, CRISPR KO Vector (All-in-one System) (chicken β-actin promoter:Cas9-2A-Puro-U6:sgRNA) | Mammal | E. coli, Mammalian cells | Plasmid |
| STCRI24414 | Chicken β-actin promoter:Cas9-2A-EGFP vector backbone | High-throughput Gene Editing Vector Backbone-Mammal, Cas9 Vector (chicken β-actin promoter:Cas9-2A-EGFP) | Mammal | E. coli, Mammalian cells | Plasmid |
| STCRI24415 | U6:sgRNA-PGK:Puro vector backbone | High-throughput Gene Editing Vector Backbone-Mammal, sgRNA Vector (U6:sgRNA-PGK:Puro) | Mammal | E. coli, Mammalian cells | Plasmid |
| STCRI24416 | CRISPRa EF-1a:dCas9-VP64-RelA(p65)AD-Rta AD-T2A-EGFP vector backbone | High-throughput Gene Editing Vector Backbone-Mammal, CRISPRa Vector (Double-Vector System 1) (EF-1a:dCas9-VP64-RelA(p65)AD-Rta AD-T2A-EGFP) | Mammal | E. coli, Mammalian cells | Plasmid |
| STCRI24417 | CRISPRa EF-1a:dCas9-VP64-T2A-Blast vector backbone | High-throughput Gene Editing Vector Backbone-Mammal, CRISPRa Vector (Three-Vector System, SAM System 1) (EF-1a:dCas9-VP64-T2A-Blast) | Mammal | E. coli, Mammalian cells | Plasmid |
| STCRI24418 | CRISPRa EF-1a:dCas9-VP64-T2A-EGFP vector backbone | High-throughput Gene Editing Vector Backbone-Mammal, CRISPRa Vector (Three-Vector System, SAM System 1) (EF-1a:dCas9-VP64-T2A-EGFP) | Mammal | E. coli, Mammalian cells | Plasmid |
| STCRI24419 | CRISPRa EF-1a:MS2-N55K-p65-HSF1-T2A-HygR vector backbone | High-throughput Gene Editing Vector Backbone-Mammal, CRISPRa Vector (Three-Vector System, SAM System 2) (EF-1a:MS2-N55K-p65-HSF1-T2A-HygR) | Mammal | E. coli, Mammalian cells | Plasmid |
| STCRI24420 | CRISPRa U6:sgRNA-MS2 stem loop-PGK:puro-T2A-BFP vector backbone | High-throughput Gene Editing Vector Backbone-Mammal, CRISPRa Vector (Three-Vector System, SAM System 3) (U6:sgRNA-MS2 stem loop-PGK:puro-T2A-BFP) | Mammal | E. coli, Mammalian cells | Plasmid |
| STCRI24421 | CRISPRi U6:sgRNA-hUbC promoter:dCas9-KRAB-T2A-Puro vector backbone | High-throughput Gene Editing Vector Backbone-Mammal, CRISPRi Vector (All-in-one System) (U6:sgRNA-hUbC promoter:dCas9-KRAB-T2A-Puro) | Mammal | E. coli, Mammalian cells | Plasmid |
| STCRI24422 | CRISPR 35s:Cas9-AtU6-26:sgRNA vector backbone | High-throughput Gene Editing Vector Backbone-Plant, CRISPR KO Vector (All-in-one System) (35s:Cas9-AtU6-26:sgRNA) | Plant | E. coli, Plant cells | Plasmid |
| STCRI24423 | CRISPR 35s:Cas9-AtU6-26:sgRNA vector backbone | High-throughput Gene Editing Vector Backbone-Plant, CRISPR KO Vector (All-in-one System) (35s:Cas9-AtU6-26:sgRNA) | Plant | E. coli, Plant cells | Plasmid |
| STCRI24424 | CRISPR rice snoRNA U3 promoter :sgRNA- rice Ubi:Cas9 vector backbone | High-throughput Gene Editing Vector Backbone-Plant, CRISPR KO Vector (All-in-one System) (rice snoRNA U3 promoter :sgRNA- rice Ubi:Cas9) | Plant | E. coli, Plant cells | Plasmid |
| STCRI24425 | CRISPRi T5-lac operator:dCas9-J23119:sgRNA vector backbone | High-throughput Gene Editing Vector Backbone-E. coli, CRISPRi Vector (All-in-one System) (T5-lac operator:dCas9-J23119:sgRNA) | E. coli | E. coli | Plasmid |
| STCRI24426 | J23119 (SpeI) :sgRNA vector backbone | High-throughput Gene Editing Vector Backbone-E. coli, sgRNA Vector (Double-Vector System) (J23119 (SpeI) :sgRNA) | E. coli | E. coli | Plasmid |
| STCRI24427 | J23119 (SpeI) :sgRNA vector backbone | High-throughput Gene Editing Vector Backbone-E. coli, sgRNA Vector (Double-Vector System) (J23119 (SpeI) :sgRNA) | E. coli | E. coli | Plasmid |
| STCRI24428 | tetR/tetA:SpCas9 vector backbone | High-throughput Gene Editing Vector Backbone-E. coli, Cas9 Vector (Double-Vector System) (tetR/tetA:SpCas9) | E. coli | E. coli | Plasmid |
| STCRI24429 | CRISPRa EC2_10_dCas9_VPR_HC_sgRNA vector backbone | High-throughput Gene Editing Vector Backbone-Yeast, CRISPRa Vector (All-in-one System) (EC2_10_dCas9_VPR_HC_sgRNA) | Yeast | E. coli, Yeast | Plasmid |
| STCRI24430 | CRISPRi EC2_3_dCas9_Mxi_sgRNA vector backbone | High-throughput Gene Editing Vector Backbone-Yeast, CRISPRi Vector (All-in-one System) (EC2_3_dCas9_Mxi_sgRNA) | Yeast | E. coli, Yeast | Plasmid |
| STCRI211101-1 | LentiCRISPR-v2-puro Syno-Human Genome CRISPR Knockout Library, sub-library A | Syno-Human Genome CRISPR Knockout Library, sub-library A: 18,913 genes are targeted, 74,552 sgRNA sequences and 435 control (non-targeted), LentiCRISPR-v2-puro vector backbone. | Human | E. coli, Human cells | Library |
| STCRI211101-2 | LentiGuide-puro Syno-Human Genome CRISPR Knockout Library, sub-library A | Syno-Human Genome CRISPR Knockout Library, sub-library A: 18,913 genes are targeted, 74,552 sgRNA sequences and 435 control (non-targeted), LentiGuide-puro vector backbone. | Human | E. coli, Human cells | Library |
| STCRI211101-3 | LentiGuide-puro-GFP Syno-Human Genome CRISPR Knockout Library, sub-library A | Syno-Human Genome CRISPR Knockout Library, sub-library A: 18,913 genes are targeted, 74,552 sgRNA sequences and 435 control (non-targeted), LentiGuide-puro-GFP vector backbone. | Human | E. coli, Human cells | Library |
| STCRI211102-1 | LentiCRISPR-v2-puro Syno-Human Genome CRISPR Knockout Library, sub-library B | Syno-Human Genome CRISPR Knockout Library, sub-library B: 18,334 genes are targeted, 71,048 sgRNA sequences and 435 control (non-targeted), LentiCRISPR-v2-puro vector backbone. | Human | E. coli, Human cells | Library |
| STCRI211102-2 | LentiGuide-puro Syno-Human Genome CRISPR Knockout Library, sub-library B | Syno-Human Genome CRISPR Knockout Library, sub-library B: 18,334 genes are targeted, 71,048 sgRNA sequences and 435 control (non-targeted), LentiGuide-puro vector backbone. | Human | E. coli, Human cells | Library |
| STCRI211102-3 | LentiGuide-puro-GFP Syno-Human Genome CRISPR Knockout Library, sub-library B | Syno-Human Genome CRISPR Knockout Library, sub-library B: 18,334 genes are targeted, 71,048 sgRNA sequences and 435 control (non-targeted), LentiGuide-puro-GFP vector backbone. | Human | E. coli, Human cells | Library |
| STCRI211103-1 | LentiCRISPR-v2-puro Syno-Human Genome CRISPR Knockout Library, sub-library C | Syno-Human Genome CRISPR Knockout Library, sub-library C: 8,761 genes are targeted, 37,522 sgRNA sequences and 200 control (non-targeted), LentiCRISPR-v2-puro vector backbone. | Human | E. coli, Human cells | Library |
| STCRI211103-2 | LentiGuide-puro Syno-Human Genome CRISPR Knockout Library, sub-library C | Syno-Human Genome CRISPR Knockout Library, sub-library C: 8,761 genes are targeted, 37,522 sgRNA sequences and 200 control (non-targeted), LentiGuide-puro vector backbone. | Human | E. coli, Human cells | Library |
| STCRI211103-3 | LentiGuide-puro-GFP Syno-Human Genome CRISPR Knockout Library, sub-library C | Syno-Human Genome CRISPR Knockout Library, sub-library C: 8,761 genes are targeted, 37,522 sgRNA sequences and 200 control (non-targeted), LentiGuide-puro-GFP vector backbone. | Human | E. coli, Human cells | Library |
| STCRI233301 | Syno-Human Genome CRISPR Activation Library, sub-library A | Syno-Human Genome CRISPR Activation Library, sub-library A: 18,885 genes are targeted, 56,266 sgRNA sequences and 496 control (non-targeted), Syn-pXPR_502 vector backbone. | Human | E. coli, Human cells | Library |
| STCRI233302 | Syno-Human Genome CRISPR Activation Library, sub-library B | Syno-Human Genome CRISPR Activation Library, sub-library B: 18,843 genes are targeted, 55,980 sgRNA sequences and 496 control (non-targeted), Syn-pXPR_502 vector backbone. | Human | E. coli, Human cells | Library |
| STCRI24301 | Syno-Human Genome Knockout Negative Control Library, 20 controls | Syno-Human Genome Knockout Negative Control Library, 20 control (non-targeted) sgRNA sequences, pLentiCRISPR v2-Puro vector backbone. | Human | E. coli, Human cells | Library |
| STCRI24302 | Syno-Human Genome Knockout Negative Control Library, 50 controls | Syno-Human Genome Knockout Negative Control Library, 50 control (non-targeted) sgRNA sequences, pLentiCRISPR v2-Puro vector backbone. | Human | E. coli, Human cells | Library |
| STCRI24303 | Syno-Human Genome Knockout Negative Control Library, 100 controls | Syno-Human Genome Knockout Negative Control Library, 100 control (non-targeted) sgRNA sequences, pLentiCRISPR v2-Puro vector backbone. | Human | E. coli, Human cells | Library |
| STCRI24304 | Syno-Human Genome Knockout Negative Control Library, 200 controls | Syno-Human Genome Knockout Negative Control Library, 200 control (non-targeted) sgRNA sequences, pLentiCRISPR v2-Puro vector backbone. | Human | E. coli, Human cells | Library |
| STCRI24305 | Syno-Human Genome Knockout Negative Control Library, 500 controls | Syno-Human Genome Knockout Negative Control Library, 500 control (non-targeted) sgRNA sequences, pLentiCRISPR v2-Puro vector backbone. | Human | E. coli, Human cells | Library |
| STCRI24306 | Syno-Human Genome Knockout Negative Control Library, 1000 controls | Syno-Human Genome Knockout Negative Control Library, 1000 control (non-targeted) sgRNA sequences, pLentiCRISPR v2-Puro vector backbone. | Human | E. coli, Human cells | Library |
| STCRI24307 | Syno-Human Genome Knockout Negative Control Library, 2000 controls | Syno-Human Genome Knockout Negative Control Library, 2000 control (non-targeted) sgRNA sequences, pLentiCRISPR v2-Puro vector backbone. | Human | E. coli, Human cells | Library |
| STCRI113345 | Syno-Human Membrane Protein CRISPR Activation Library | Syno-Human Membrane Protein CRISPR Activation Library, 6,213 genes are targeted, 58,071 sgRNA sequences and 500 control (non-targeted), pKVL2-U6gRNA_ SAM(BbsI)-PGKpuroBFP-W vector backbone. | Human | E. coli, Human cells | Library |
| SHPF231311 | Syno-Human ABC Transporter Pathway Library | Syno-Human ABC Transporter Pathway Library, 100 genes are targeted, 516 sgRNA sequences, pLentiCRISPR-v2-puro vector backbone. | Human | E. coli, Human cells | Library |
| SHPF231312 | Syno-Human Acute Myeloid Leukemia Pathway Library | Syno-Human Acute Myeloid Leukemia Pathway Library, 45 genes are targeted, 192 sgRNA sequences, pLentiCRISPR-v2-puro vector backbone. | Human | E. coli, Human cells | Library |
| SHPF231313 | Syno-Human Adipogenesis Pathway Library | Syno-Human Adipogenesis Pathway Library, 126 genes are targeted, 564 sgRNA sequences, pLentiCRISPR-v2-puro vector backbone. | Human | E. coli, Human cells | Library |
| SHPF231314 | Syno-Human Adult Stem Cell Pathway Library | Syno-Human Adult Stem Cell Pathway Library, 58 genes are targeted, 260 sgRNA sequences, pLentiCRISPR-v2-puro vector backbone. | Human | E. coli, Human cells | Library |
| SHPF231315 | Syno-Human Angiogenesis Pathway Library | Syno-Human Angiogenesis Pathway Library, 92 genes are targeted, 404 sgRNA sequences, pLentiCRISPR-v2-puro vector backbone. | Human | E. coli, Human cells | Library |
| SHPF231316 | Syno-Human apoptosis Pathway Library | Syno-Human apoptosis Pathway Library, 67 genes are targeted, 312 sgRNA sequences, pLentiCRISPR-v2-puro vector backbone. | Human | E. coli, Human cells | Library |
| SHPF231317 | Syno-Human cAMP&Ca Pathway Library | Syno-Human cAMP&Ca Pathway Library, 91 genes are targeted, 412 sgRNA sequences, pLentiCRISPR-v2-puro vector backbone. | Human | E. coli, Human cells | Library |
| SHPF231318 | Syno-Human Cell Cycle Pathway Library | Syno-Human Cell Cycle Pathway Library, 84 genes are targeted, 348 sgRNA sequences, pLentiCRISPR-v2-puro vector backbone. | Human | E. coli, Human cells | Library |
| SHPF231319 | Syno-Human Chemokine Pathway Library | Syno-Human Chemokine Pathway Library, 134 genes are targeted, 624 sgRNA sequences, pLentiCRISPR-v2-puro vector backbone. | Human | E. coli, Human cells | Library |
| SHPF231320 | Syno-Human Drug Resistance Pathway Library | Syno-Human Drug Resistance Pathway Library, 348 genes are targeted, 1540 sgRNA sequences, pLentiCRISPR-v2-puro vector backbone. | Human | E. coli, Human cells | Library |
| SHPF231321 | Syno-Human ES Differentiation Pathway Library | Syno-Human ES Differentiation Pathway Library, 334 genes are targeted, 1432 sgRNA sequences, pLentiCRISPR-v2-puro vector backbone. | Human | E. coli, Human cells | Library |
| SHPF231322 | Syno-Human GPCR Pathway Library | Syno-Human GPCR Pathway Library, 280 genes are targeted, 1204 sgRNA sequences, pLentiCRISPR-v2-puro vector backbone. | Human | E. coli, Human cells | Library |
| SHPF231323 | Syno-Human Hormone Activity Pathway Library | Syno-Human Hormone Activity Pathway Library, 108 genes are targeted, 448 sgRNA sequences, pLentiCRISPR-v2-puro vector backbone. | Human | E. coli, Human cells | Library |
| SHPF231324 | Syno-Human Ion Channel Pathway Library | Syno-Human Ion Channel Pathway Library, 67 genes are targeted, 284 sgRNA sequences, pLentiCRISPR-v2-puro vector backbone. | Human | E. coli, Human cells | Library |
| SHPF231325 | Syno-Human P450 Pathway Library | Syno-Human P450 Pathway Library, 57 genes are targeted, 272 sgRNA sequences, pLentiCRISPR-v2-puro vector backbone. | Human | E. coli, Human cells | Library |
| SHPF231326 | Syno-Human Tumor Metastasis Pathway Library | Syno-Human Tumor Metastasis Pathway Library, 60 genes are targeted, 252 sgRNA sequences, pLentiCRISPR-v2-puro vector backbone. | Human | E. coli, Human cells | Library |
| SHPF231327 | Syno-Human Tumor Suppressor Pathway Library | Syno-Human Tumor Suppressor Pathway Library, 720 genes are targeted, 3188 sgRNA sequences, pLentiCRISPR-v2-puro vector backbone. | Human | E. coli, Human cells | Library |
| SHPF231328 | Syno-Human Neelamegham Human Glycogene Pathway Library | Syno-Human Neelamegham Human Glycogene Pathway Library, 347 genes are targeted, 1520 sgRNA sequences, pLentiCRISPR-v2-puro vector backbone. | Human | E. coli, Human cells | Library |
| SHPF231329 | Syno-Human mTORC1 Focused Pathway Library | Syno-Human mTORC1 Focused Pathway Library, 712 genes are targeted, 3233 sgRNA sequences, pLentiCRISPR-v2-puro vector backbone. | Human | E. coli, Human cells | Library |
| SHPF231331 | Syno-Human Interferon Stimulated gene Pathway Library | Syno-Human Interferon Stimulated gene Pathway Library, 1914 genes are targeted, 9307 sgRNA sequences, pLentiCRISPR-v2-puro vector backbone. | Human | E. coli, Human cells | Library |
| SHPF233002 | Syno-Human mRNA Surveillance Pathway Library | Syno-Human mRNA Surveillance Pathway Library, 107 genes are targeted, 428 sgRNA sequences, pLentiCRISPR-v2-puro vector backbone. | Human | E. coli, Human cells | Library |
| SHPF234001 | Syno-Human Autophagy Pathway Library | Syno-Human Autophagy Pathway Library, 141 genes are targeted, 596 sgRNA sequences, pLentiCRISPR-v2-puro vector backbone. | Human | E. coli, Human cells | Library |
| SHPF234002 | Syno-Human Endocytosis Pathway Library | Syno-Human Endocytosis Pathway Library, 252 genes are targeted, 1268 sgRNA sequences, pLentiCRISPR-v2-puro vector backbone. | Human | E. coli, Human cells | Library |
| SHPF234003 | Syno-Human Lysosome Pathway Library | Syno-Human Lysosome Pathway Library, 132 genes are targeted, 600 sgRNA sequences, pLentiCRISPR-v2-puro vector backbone. | Human | E. coli, Human cells | Library |
| SHPF234004 | Syno-Human Mitophagy Pathway Library | Syno-Human Mitophagy Pathway Library, 73 genes are targeted, 328 sgRNA sequences, pLentiCRISPR-v2-puro vector backbone. | Human | E. coli, Human cells | Library |
| SHPF234005 | Syno-Human Peroxisome Pathway Library | Syno-Human Peroxisome Pathway Library, 83 genes are targeted, 352 sgRNA sequences, pLentiCRISPR-v2-puro vector backbone. | Human | E. coli, Human cells | Library |
| SHPF235002 | Syno-Human Focal adhesion pahway | Syno-Human Focal Adhesion Pahway Library, 202 genes are targeted, 872 sgRNA sequences, pLentiCRISPR-v2-puro vector backbone. | Human | E. coli, Human cells | Library |
| STCRI221420 | Syno E. coli (K12 MG1655) Genome CRISPR Interference Library | Syno E. coli (K12 MG1655) Genome CRISPR Interference Library, 55671 sgRNA sequences, 400 negative control (non-targrted), pdCas9-E4 vector backbone. | E. coli | E. coli | Library |
| STCRI222531 | Syno yeast (Saccharomyces cerevisias KE6-12) Genome CRISPR Interference Library | Syno yeast (Saccharomyces cerevisias KE6-12) Genome CRISPR Interference Library, 6654 genes are targeted, 61094 sgRNA sequences, dCas9_Mxi_sgRNA vector backbone. | Yeast | E. coli, Yeast | Library |
| STCRI222532 | Syno yeast (Saccharomyces cerevisias KE6-12) Genome CRISPR Activation Library | Syno yeast (Saccharomyces cerevisias KE6-12) Genome CRISPR Activation Library, 6654 genes are targeted, 61094 sgRNA sequences, dCas9_VPR_HC_sgRNA vector backbone. | Yeast | E. coli, Yeast | Library |
| STCRI100088 | Syno Sheep Genome CRISPR Knockout Library | Syno Sheep Genome CRISPR Knockout Library, 20,400 targeted genes, 118,626 sgRNA sequences and 1,000 control (non-targeted), pLentiCRISPR-v2-puro vector backbone. | Sheep | E. coli, Mammalian cells | Library |
| STCRI100100 | Syno Rabbit Genome CRISPR Knockout Library | Syno Rabbit Genome CRISPR Knockout Library, 19,669 targeted genes, 77,192 sgRNA sequences and 1,000 control (non-targeted), pLentiguide-puro vector backbone. | Rabbit | E. coli, Mammalian cells | Library |
| STCRI100137 | Syno Dog Genome CRISPR Knockout Library | Syno Dog Genome CRISPR Knockout Library, 19,523 targeted genes, 77,440 sgRNA sequences and 1,000 control (non-targeted), pLentiCRISPR-v2-puro vector backbone. | Dog | E. coli, Mammalian cells | Library |
| STCRI100115-1 | pLentiCRISPR-v2-puro Syno Pig Genome CRISPR Knockout Library | Syno Pig Genome CRISPR Knockout Library, 20,661 targeted genes, 123951 sgRNA sequences and 2,000 control (non-targeted), pLentiCRISPR-v2-puro vector backbone. | Pig | E. coli, Mammalian cells | Library |
| STCRI100115-2 | pLentiguide-puro Syno Pig Genome CRISPR Knockout Library | Syno Pig Genome CRISPR Knockout Library, 20,661 targeted genes, 123951 sgRNA sequences and 2,000 control (non-targeted), pLentiguide-puro vector backbone. | Chicken | E. coli, Avian cells | Library |
| STCRI100063 | Syno Chicken Genome CRISPR Knockout Library | Syno Chicken Genome CRISPR Knockout Library, 16,338 targeted genes, 48,798 sgRNA sequences and 1,000 control (non-targeted), pLentiCRISPR-v2-puro vector backbone. | Duck | E. coli, Avian cells | Library |
| STCRI100075 | Syno Duck Genome CRISPR Knockout Library | Syno Duck Genome CRISPR Knockout Library, 15,746 targeted genes, 61,430 sgRNA sequences and 1,000 control (non-targeted), pLentiCRISPR-v2-puro vector backbone. | Mouse | E. coli, Mammalian cells | Library |
| STCRI100052-1 | pLentiCRISPR-v2-puro Mouse Genome CRISPR Knockout Library | Mouse Genome CRISPR Knockout Library, 20,611 targeted genes, 1,175 miRNA sequences and 3 sgRNA/gene, pLentiCRISPR-v2-puro vector backbone. | Mouse | E. coli, Mammalian cells | Library |
| STCRI100052-2 | pLentiguide-puro Mouse Genome CRISPR Knockout Library | Mouse Genome CRISPR Knockout Library, 20,611 targeted genes, 130,209 sgRNA sequences, pLentiguide-puro vector backbone. | Mouse | E. coli, Mammalian cells | Library |
| STCRI240053 | Mouse Membrane Protein CRISPR Knockout Library | Mouse Membrane Protein CRISPR Knockout Library, 1,157 targeted genes and 4,993 sgRNA, pLentiCRISPR-v2-puro vector backbone. | Mouse | E. coli, Mammalian cells | Library |
| STCRI240054 | Mouse Metabolism Protein CRISPR Knockout Library | Mouse Metabolism Protein CRISPR Knockout Library, 2,918 targeted genes, 18,342 sgRNA and 1,000 control, pLentiCRISPR-v2-puro vector backbone. | Mouse | E. coli, Mammalian cells | Library |
| HX002324-5 | ProXpress (His-Tag) - Competitive | Quick protein expression test kit, for detection of His-tagged proteins obtained from prokaryotic and eukaryotic expression systems. Chromatography-based competitive assay. | N/A | N/A | Kit |
| HX002327-5 | ProXpress (His-Tag-PLUS) -Competitive | Quick protein expression test kit, for detection of His-tagged proteins obtained from prokaryotic and eukaryotic expression systems. Optimized for low-concentration proteins. Chromatography-based competitive assay. | N/A | N/A | Kit |
| HX002323-5 | ProXpress (Flag-Tag) - Competitive | Quick protein expression test kit, for detection of Flag-tagged proteins obtained from prokaryotic and eukaryotic expression systems. Chromatography-based competitive assay. | N/A | N/A | Kit |
| HX002322-5 | ProXpress (GST-Tag) | Quick protein expression test kit, for detection of GST-tagged proteins obtained from prokaryotic and eukaryotic expression systems. Chromatography-based sandwich assay. | N/A | N/A | Kit |
| HX002321-5 | ProXpress (Flag-His-Tag) | Quick protein expression test kit, for detection of Flag-His -tagged proteins obtained from prokaryotic and eukaryotic expression systems. Chromatography-based sandwich assay. | N/A | N/A | Kit |
| HX002325-5 | ProXpress (Human IgG-Fc) | Quick protein expression test kit, for detection of Human IgG antibody products obtained from Human serum and eukaryotic expression systems. Chromatography-based sandwich assay. | N/A | N/A | Kit |
| HX002326-5 | ProXpress (Mouse IgG-Fc) | Quick protein expression test kit, for detection of Mouse IgG antibodies (or recombinant protein products with mouse Fc fragments) obtained from eukaryotic expression systems. Chromatography-based sandwich assay. | N/A | N/A | Kit |
| Recombinant Streptavidin, 1 mg | Recombinant streptavidin produced via E. coli expression system. Non-glycosylated protein with exceptional affinity for biotin, ideal for use in immunology and molecular diagnostics. Purity ≥95%, activity 15.0 units/mg. Storage buffer: 1×PBS pH 7.4. N-terminal His tag. Full sequence: MNHKVHHHHHHDPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNA ESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWL LTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ | N/A | N/A | Protein | |
| Recombinant Streptavidin, 10 mg | Recombinant streptavidin produced via E. coli expression system. Non-glycosylated protein with exceptional affinity for biotin, ideal for use in immunology and molecular diagnostics. Purity ≥95%, activity 15.0 units/mg. Storage buffer: 1×PBS pH 7.4. N-terminal His tag. Full sequence: MNHKVHHHHHHDPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNA ESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWL LTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ | N/A | N/A | Protein | |
| Recombinant Streptavidin, 100 mg | Recombinant streptavidin produced via E. coli expression system. Non-glycosylated protein with exceptional affinity for biotin, ideal for use in immunology and molecular diagnostics. Purity ≥95%, activity 15.0 units/mg. Storage buffer: 1×PBS pH 7.4. N-terminal His tag. Full sequence: MNHKVHHHHHHDPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNA ESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWL LTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ | N/A | N/A | Protein | |
| Protein A | Recombinant Protein A produced via E. coli expression system. Molecular weight 33.4 kDa, purity > 95% by SDS-PAGE, concentration 4.48 mg/ml, < 0.1 EU/μg of protein by the LAL method. Storage buffer: 1×PBS pH 7.4. Full sequence: NAAQHDEAQQ NAFYQVLNMP NLNADQRNGF IQSLKDDPSQ SANVLGEAQK LNDSQAPKAD AQQNNFNKDQ QSAFYEILNM PNLNEAQRNG FIQSLKDDPS QSTNVLGEAK KLNESQAPKA DNNFNKEQQN AFYEILNMPN LNEEQRNGFI QSLKDDPSQS ANLLSEAKKL NESQAPKADN KFNKEQQNAF YEILHLPNLN EEQRNGFIQS LKDDPSQSAN LLAEAKKLND AQAPKADNKF NKEQQNAFYE ILHLPNLTEE QRNGFIQSLK DDPSVSKEIL AEAKKLNDAQ APKEED | N/A | N/A | Protein | |
| Protein G | Recombinant Protein G produced via E. coli expression system. Molecular weight 21.9 kDa with a Cys on the N-terminus, single non-glycosylated polypeptide chain containing 201 amino acids. It migrates with an apparent molecular weight of 40kDa by SDS-PAGE. Purity > 95% by SDS-PAGE , concentration 0.729 mg/ml, < 0.1 EU/μg of protein by the LAL method. Storage buffer: 1×PBS pH 7.4. Full sequence: CLPKTDTYKL ILNGKTLKGE TTTEAVDAAT AEKVFKQYAN DNGVDGEWTY DDATKTFTVT EKPEVIDASE LTPAVTTYKL VINGKTLKGE TTTEAVDAAT AEKVFKQYAN DNGVDGEWTY DDATKTFTVT EKPEVIDASE LTPAVTTYKL VINGKTLKGE TTTKAVDAET AEKAFKQYAN DNGVDGVWTY DDATKTFTVT E | N/A | N/A | Protein | |
| Protein L | Recombinant Protein L produced via E. coli expression system. Molecular weight 41.5 kDa, purity > 95% by SDS-PAGE, concentration 1.16 mg/ml, < 0.1 EU/μg of protein by the LAL method. Storage buffer: 1×PBS pH 7.4. N-terminal His tag. Full sequence: MHHHHHHKEE TPETPETDSE EEVTIKANLI FANGSTQTAE FKGTFEKATS EAYAYADTLK KDNGEYTVDV ADKGYTLNIK FAGKEKTPEE PKEEVTIKAN LIYADGKTQT AEFKGTFEEA TAEAYRYADA LKKDNGEYTV DVADKGYTLN IKFAGKEKTP EEPKEEVTIK ANLIYADGKT QTAEFKGTFE EATAEAYRYA DLLAKENGKY TVDVADKGYT LNIKFAGKEK TPEEPKEEVT IKANLIYADG KTQTAEFKGT FAEATAEAYR YADLLAKENG KYTADLEDGG YTINIRFAGK KVDEKPEEKE QVTIKENIYF EDGTVQTATF KGTFAEATAE AYRYADLLSK EHGKYTADLE DGGYTINIRF AG | N/A | N/A | Protein |
SYNBIO의 모든 제품을 만나 보세요!
SERVICES
PRODUCTS
ONE STOP SOLUTION
High Performing DNA-RNA-Protein Molecules
Oligonucleotide Diagnostics & Therapeutics
SYNBIO Technologies - Exclusive Distributor in South Korea "Morebio" 한국 독점 대리점 "모아바이오"
MSDS
온라인 견적
