
Proteogenix는 Primary Antibody Biosimilar - Research Grade
제품을 전문적으로 생산하는 20년의 경험이 있는 High Quality 제조사입니다.
제품 설명
Human ICAM1, CD54 Recombinant Protein
제품 번호
PX-P3044
제품 특징
Product name | Human ICAM1, CD54 Recombinant Protein |
---|
Uniprot ID | P05362 |
---|
Uniprot link | http://www.uniprot.org/uniprot/P05362 |
---|
Origin species | Homo sapiens (Human) |
---|
Expression system | Prokaryotic expression |
---|
Sequence | QTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYE |
---|
Molecular weight | 50.34 kDa |
---|
Purity estimated | 95% |
---|
Buffer | PBS,pH 7.5 urea +8M |
---|
Form | Frozen |
---|
Delivery condition | Dry Ice |
---|
Delivery lead time in business days | 5-7 |
---|
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
---|
Brand | ProteoGenix |
---|
Host species | Escherichia coli (E.coli) |
---|
Applications | ELISA,WB |
---|
Fragment Type | Partial |
---|
NCBI Reference | P05362 |
---|
Aliases /Synonyms | CD54, BB2, P3.58, Human Rhinovirus Receptor, Major group rhinovirus receptor, Intercellular Adhesion Molecule 1, Major group rhinovirus receptor, ICAM-1 |
---|
Reference | PX-P3044 |
---|
Note | For research use only |
---|
Publications
- 1: Igarashi Y, Morishita Y, Yoshizawa H, Imai R, Imai T, Hirahara I, Akimoto T, Ookawara S, Ishibashi K, Muto S, Nagata D. The association between soluble intercellular adhesion molecule-1 levels in drained dialysate and peritoneal injury in peritoneal dialysis. Ren Fail. 2017 Nov;39(1):392-399. doi: 10.1080/0886022X.2017.1287735. PubMed PMID: 28201944.
- 2: Chang PY, Tsao SM, Chang JH, Chien MH, Hung WY, Huang YW, Yang SF. Plasma levels of soluble intercellular adhesion molecule-1 as a biomarker for disease severity of patients with community-acquired pneumonia. Clin Chim Acta. 2016 Dec 1;463:174-180. doi: 10.1016/j.cca.2016.10.030. Epub 2016 Oct 28. PubMed PMID: 27983998.
- 3: Lee YH, Bae SC. Intercellular adhesion molecule-1 polymorphisms, K469E and G261R and susceptibility to vasculitis and rheumatoid arthritis: a meta-analysis. Cell Mol Biol (Noisy-le-grand). 2016 Oct 31;62(12):84-90. doi: 10.14715/cmb/2016.62.12.15. PubMed PMID: 27894415.
- 4: Schaefer M, Sarkar S, Schwarz M, Friebe A. Soluble Intracellular Adhesion Molecule-1 in Patients with Unipolar or Bipolar Affective Disorders: Results from a Pilot Trial. Neuropsychobiology. 2016;74(1):8-14. doi: 10.1159/000446919. Epub 2016 Jul 22. PubMed PMID: 27442531.
- 5: Sharma S, Singh SK, Kakkar K, Nyari N, Singh D, Dhole TN, Kashyap R, Hasan S. Association of ICAM-1 K469E polymorphism with dengue infection in North Indian population. Microb Pathog. 2016 Jul;96:80-4. doi: 10.1016/j.micpath.2016.05.006. Epub 2016 May 11. PubMed PMID: 27179462.
- 6: Novikov VV, Shumilova SV, Novikov DV, Kalugin AV, Fomina SG, Karaulov AV. Genetic Instability in Locus rs5498 E469K (A/G) of ICAM-1 Gene in Patients with Colorectal Cancer and Breast Cancer. Bull Exp Biol Med. 2016 Apr;160(6):811-3. doi: 10.1007/s10517-016-3316-3. Epub 2016 May 12. PubMed PMID: 27169635.
- 7: Yousuf SD, Ganie MA, Zargar MA, Parvez T, Rashid F. The ICAM-1 Gly241Arg Polymorphism is Not Associated With Polycystic Ovary Syndrome - Results from a Case Control study in Kashmir, India. Asian Pac J Cancer Prev. 2016;17(3):1583-8. PubMed PMID: 27039809.
- 8: Poniedziałek-Czajkowska E, Mierzyński R, Szymula D, Leszczyńska-Gorzelak B, Oleszczuk J. Intercellular Adhesion Molecule and Endogenous NOS Inhibitor: Asymmetric Dimethylarginine in Pregnant Women with Gestational Diabetes Mellitus. J Diabetes Res. 2016;2016:1342643. doi: 10.1155/2016/1342643. Epub 2016 Feb 11. PubMed PMID: 26981539; PubMed Central PMCID: PMC4766337.
- 9: Zhang X, Huang J, Bai J, Lu W, Zhang M, Mei H. Association of Polymorphisms in Intercellular Adhesion Molecule 1 (ICAM-1) Gene with Cancer Susceptibility: A Meta-Analysis of 14 Case-Control Studies. Med Sci Monit. 2016 Feb 21;22:569-79. PubMed PMID: 26897511; PubMed Central PMCID: PMC4763808.
- 10: Tang DD, Niu HX, Peng FF, Long HB, Liu ZR, Zhao H, Chen YH. Hypochlorite-Modified Albumin Upregulates ICAM-1 Expression via a MAPK-NF-κB Signaling Cascade: Protective Effects of Apocynin. Oxid Med Cell Longev. 2016;2016:1852340. doi: 10.1155/2016/1852340. Epub 2016 Jan 10. PubMed PMID: 26881015; PubMed Central PMCID: PMC4736979.
- 11: Di D, Chen L, Wang L, Sun P, Liu Y, Xu Z, Ju J. Downregulation of human intercellular adhesion molecule-1 attenuates the metastatic ability in human breast cancer cell lines. Oncol Rep. 2016 Mar;35(3):1541-8. doi: 10.3892/or.2016.4543. Epub 2016 Jan 5. PubMed PMID: 26751847.
- 12: Wang D, Zhang FH, Zhao YT, Xiao XG, Liu S, Shi HB, Lin AL, Wang YJ, Han Q, Sun QM. Association of polymorphism in ICAM-1 (K469E) and cytology parameters in patients' initial blood test with acute ischemic stroke. Genet Mol Res. 2015 Dec 2;14(4):15520-9. doi: 10.4238/2015.December.1.2. PubMed PMID: 26634518.
- 13: Taranta-Janusz K, Wasilewska A, Roszkowska R, Michaluk-Skutnik J. Is urine intercellular adhesion molecule-1 a marker of renal disorder in children with ureteropelvic junction obstruction? Biomarkers. 2016;21(2):123-8. doi: 10.3109/1354750X.2015.1118543. Epub 2015 Dec 3. PubMed PMID: 26631256.
- 14: Tsai ST, Wang PJ, Liou NJ, Lin PS, Chen CH, Chang WC. ICAM1 Is a Potential Cancer Stem Cell Marker of Esophageal Squamous Cell Carcinoma. PLoS One. 2015 Nov 16;10(11):e0142834. doi: 10.1371/journal.pone.0142834. eCollection 2015. PubMed PMID: 26571024; PubMed Central PMCID: PMC4646358.
- 15: Othumpangat S, Noti JD, McMillen CM, Beezhold DH. ICAM-1 regulates the survival of influenza virus in lung epithelial cells during the early stages of infection. Virology. 2016 Jan;487:85-94. doi: 10.1016/j.virol.2015.10.005. Epub 2015 Oct 23. PubMed PMID: 26499045; PubMed Central PMCID: PMC4719144.
ProteoGenix의 모든 제품들을 만나보세요!
Proteogenix - Exclusive Distributor in South Korea "Morebio" 한국 독점 대리점 "모아바이오"