
Proteogenix는 Primary Antibody Biosimilar - Research Grade
제품을 전문적으로 생산하는 20년의 경험이 있는 High Quality 제조사입니다.
제품 설명
Human eIF4G Recombinant Protein
제품 번호
PX-P2069
제품 특징
Product name | Human eIF4G Recombinant Protein |
---|
Origin species | Homo sapiens (Human) |
---|
Expression system | Prokaryotic expression |
---|
Sequence | MGSHHHHHHSGMSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAESEGSGVPPRPEEADETWDSKEDKIHNAENIQPGEQKYEYKSDQWKPLNLEEKKRYDREFLLGFQFIFASMQKPEGLPHISDVVLDKANK |
---|
Molecular weight | 23.49kDa |
---|
Protein delivered with Tag? | N-ter His&Trx Tag |
---|
Purity estimated | ≥95% |
---|
Buffer | PBS, imidazole 200mM + 50% glycérol |
---|
Form | liquid |
---|
Delivery condition | Dry Ice |
---|
Delivery lead time in business days | 2-3 |
---|
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
---|
Brand | ProteoGenix |
---|
Host species | Escherichia coli (E.coli) |
---|
Applications | ELISA,WB |
---|
Fragment Type | Glu557~Lys646 |
---|
Protein Accession | EAW78268.1 |
---|
NCBI Reference | WP_001583586 |
---|
Aliases /Synonyms | EIF-4G1, EIF4F, EIF4G, EIF4GI, P220, PARK18 |
---|
Reference | PX-P2069 |
---|
Note | For research use only |
---|
Publications
- 1: Nichols N, Bras JM, Hernandez DG, Jansen IE, Lesage S, Lubbe S, Singleton AB; International Parkinson's Disease Genomics Consortium.. EIF4G1 mutations do not cause Parkinson's disease. Neurobiol Aging. 2015 Aug;36(8):2444.e1-4. doi: 10.1016/j.neurobiolaging.2015.04.017. Epub 2015 May 9. PubMed PMID: 26022768; PubMed Central PMCID: PMC4464946.
- 2: Deng H, Wu Y, Jankovic J. The EIF4G1 gene and Parkinson's disease. Acta Neurol Scand. 2015 Aug;132(2):73-8. doi: 10.1111/ane.12397. Epub 2015 Mar 13. Review. PubMed PMID: 25765080.
- 3: Huttenlocher J, Krüger R, Capetian P, Lohmann K, Brockmann K, Csoti I, Klein C, Berg D, Gasser T, Bonin M, Riess O, Bauer P. EIF4G1 is neither a strong nor a common risk factor for Parkinson's disease: evidence from large European cohorts. J Med Genet. 2015 Jan;52(1):37-41. doi: 10.1136/jmedgenet-2014-102570. Epub 2014 Nov 3. PubMed PMID: 25368108.
- 4: Akabayov SR, Akabayov B, Wagner G. Human translation initiation factor eIF4G1 possesses a low-affinity ATP binding site facing the ATP-binding cleft of eIF4A in the eIF4G/eIF4A complex. Biochemistry. 2014 Oct 21;53(41):6422-5. doi: 10.1021/bi500600m. Epub 2014 Oct 8. PubMed PMID: 25255371; PubMed Central PMCID: PMC4204880.
- 5: Attar-Schneider O, Drucker L, Zismanov V, Tartakover-Matalon S, Lishner M. Targeting eIF4GI translation initiation factor affords an attractive therapeutic strategy in multiple myeloma. Cell Signal. 2014 Sep;26(9):1878-87. doi: 10.1016/j.cellsig.2014.05.005. Epub 2014 May 9. PubMed PMID: 24815186.
- 6: Nishioka K, Funayama M, Vilariño-Güell C, Ogaki K, Li Y, Sasaki R, Kokubo Y, Kuzuhara S, Kachergus JM, Cobb SA, Takahashi H, Mizuno Y, Farrer MJ, Ross OA, Hattori N. EIF4G1 gene mutations are not a common cause of Parkinson's disease in the Japanese population. Parkinsonism Relat Disord. 2014 Jun;20(6):659-61. doi: 10.1016/j.parkreldis.2014.03.004. Epub 2014 Mar 18. PubMed PMID: 24704100; PubMed Central PMCID: PMC4034257.
- 7: Blanckenberg J, Ntsapi C, Carr JA, Bardien S. EIF4G1 R1205H and VPS35 D620N mutations are rare in Parkinson's disease from South Africa. Neurobiol Aging. 2014 Feb;35(2):445.e1-3. doi: 10.1016/j.neurobiolaging.2013.08.023. Epub 2013 Sep 27. PubMed PMID: 24080171.
- 8: Li K, Tang BS, Guo JF, Lou MX, Lv ZY, Liu ZH, Tian Y, Song CY, Xia K, Yan XX. Analysis of EIF4G1 in ethnic Chinese. BMC Neurol. 2013 Apr 26;13:38. doi: 10.1186/1471-2377-13-38. PubMed PMID: 23617574; PubMed Central PMCID: PMC3663786.
- 9: Yuan L, Song Z, Xu H, Gu S, Zhu A, Gong L, Zhao Y, Deng H. EIF4G1 Ala502Val and Arg1205His variants in Chinese patients with Parkinson disease. Neurosci Lett. 2013 May 24;543:69-71. doi: 10.1016/j.neulet.2013.02.056. Epub 2013 Apr 2. PubMed PMID: 23562511.
- 10: Siitonen A, Majounie E, Federoff M, Ding J, Majamaa K, Singleton AB. Mutations in EIF4G1 are not a common cause of Parkinson's disease. Eur J Neurol. 2013 Apr;20(4):e59. doi: 10.1111/ene.12051. PubMed PMID: 23490116.
- 11: Dobrikov MI, Dobrikova EY, Gromeier M. Dynamic regulation of the translation initiation helicase complex by mitogenic signal transduction to eukaryotic translation initiation factor 4G. Mol Cell Biol. 2013 Mar;33(5):937-46. doi: 10.1128/MCB.01441-12. Epub 2012 Dec 21. PubMed PMID: 23263986; PubMed Central PMCID: PMC3623071.
- 12: Fujioka S, Sundal C, Strongosky AJ, Castanedes MC, Rademakers R, Ross OA, Vilariño-Güell C, Farrer MJ, Wszolek ZK, Dickson DW. Sequence variants in eukaryotic translation initiation factor 4-gamma (eIF4G1) are associated with Lewy body dementia. Acta Neuropathol. 2013 Mar;125(3):425-38. doi: 10.1007/s00401-012-1059-4. Epub 2012 Nov 4. PubMed PMID: 23124435; PubMed Central PMCID: PMC3580022.
- 13: Badura M, Braunstein S, Zavadil J, Schneider RJ. DNA damage and eIF4G1 in breast cancer cells reprogram translation for survival and DNA repair mRNAs. Proc Natl Acad Sci U S A. 2012 Nov 13;109(46):18767-72. doi: 10.1073/pnas.1203853109. Epub 2012 Oct 29. PubMed PMID: 23112151; PubMed Central PMCID: PMC3503184.
- 14: Zhao Y, Ho P, Prakash KM, Foo JN, Liu JJ, Au WL, Tan LC, Tan EK. Analysis of EIF4G1 in Parkinson's disease among Asians. Neurobiol Aging. 2013 Apr;34(4):1311.e5-6. doi: 10.1016/j.neurobiolaging.2012.09.003. Epub 2012 Oct 23. PubMed PMID: 23092605.
- 15: Kumar KR, Lohmann K, Klein C. Genetics of Parkinson disease and other movement disorders. Curr Opin Neurol. 2012 Aug;25(4):466-74. doi: 10.1097/WCO.0b013e3283547627. Review. PubMed PMID: 22772876.
- 16: Schulte EC, Mollenhauer B, Zimprich A, Bereznai B, Lichtner P, Haubenberger D, Pirker W, Brücke T, Molnar MJ, Peters A, Gieger C, Trenkwalder C, Winkelmann J. Variants in eukaryotic translation initiation factor 4G1 in sporadic Parkinson's disease. Neurogenetics. 2012 Aug;13(3):281-5. doi: 10.1007/s10048-012-0334-9. Epub 2012 Jun 16. PubMed PMID: 22707335.
- 17: Lesage S, Condroyer C, Klebe S, Lohmann E, Durif F, Damier P, Tison F, Anheim M, Honoré A, Viallet F, Bonnet AM, Ouvrard-Hernandez AM, Vidailhet M, Durr A, Brice A; French Parkinson's Disease Genetics Study Group.. EIF4G1 in familial Parkinson's disease: pathogenic mutations or rare benign variants? Neurobiol Aging. 2012 Sep;33(9):2233.e1-2233.e5. doi: 10.1016/j.neurobiolaging.2012.05.006. Epub 2012 Jun 1. PubMed PMID: 22658323.
ProteoGenix의 모든 제품들을 만나보세요!
Proteogenix - Exclusive Distributor in South Korea "Morebio" 한국 독점 대리점 "모아바이오"