
CUSABIO는 암, 세포 생물학, 면역학, 신경과학, 후생유전학 등 연구 분야의 글로벌 고객에게 60,000개 이상의 검증된 항체,
10,000개 이상의 재조합 단백질, 660개 이상의 사이토카인 및 수천 개의 ELISA 키트를 제공하는 검증된 제조업체 입니다.
제품 설명
Recombinant Human Sal-like protein 4 (SALL4), partial
제품 번호
CSB-BP892126HU(M)
제품 특징
Product Details
Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Developmental Biology
Alternative Names
AA407717; AL022809; AW536104; C330011P20Rik; C78083; C78563; dJ1112F19.1; DRRS; HSAL4; Sal like 4 (Drosophila); Sal like 4; Sal like Protein 4; Sal-like protein 4; Sall4; SALL4_HUMAN; Spalt like transcription factor 4; Tex20; Zinc finger protein 797; Zinc finger protein SALL4; ZNF797
Species
Homo sapiens (Human)
Expression Region
954-1053aa+11R
Target Protein Sequence
PKEILAPSVNVDPVVWNQYTSMLNGGLAVKTNEISVIQSGGVPTLPVSLGATSVVNNATVSKMDGSQSGISADVEKPSATDGVPKHQFPHFLEENKIAVS
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Insertion of the gene encoding the Human SALL4 protein (954-1053aa+11R) into a plasmid vector results in the formation of recombinant plasmid, which is then introduced into baculovirus cells. Positive baculovirus cells are selected relying on their ability to survive in the presence of a specific antibiotic. The baculovirus cells containing the recombinant plasmid are cultured under conditions conducive to the expression of the gene of interest. A N-terminal 10xHis tag and C-terminal Myc tag is attached to the protein. Following expression, the recombinant Human SALL4 protein is isolated an...Read more
Related Products
SALL4 Antibodies
SALL4 Proteins
SALL4 ELISA kits
Size
20ug, 100ug, 1mg(1mg*1 or 500ug*2)
Image

Cusabio의 다른 제품들도 함께 만나보세요!