본문 바로가기 주메뉴 바로가기

제품소개

제품상세페이지

Cusabio

[Cusabio] Recombinant Human Carboxypeptidase D (CPD), partial

Cat-No. CSB-EP005885HU1


CUSABIO는 암, 세포 생물학, 면역학, 신경과학, 후생유전학 등 연구 분야의 글로벌 고객에게 60,000개 이상의 검증된 항체, 

10,000개 이상의 재조합 단백질, 660개 이상의 사이토카인 및 수천 개의 ELISA 키트를 제공하는 검증된 제조업체 입니다. 




제품 설명


Recombinant Human Carboxypeptidase D (CPD), partial




제품 번호


CSB-EP005885HU1




제품 특징


Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
CPD
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
Carboxypeptidase D; CBPD_HUMAN; Cpd; gp180 ; Metallocarboxypeptidase D
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
383-461aa
Target Protein Sequence
GVKGFVKDSITGSGLENATISVAGINHNITTGRFGDFYRLLVPGTYNLTVVLTGYMPLTVTNVVVKEGPATEVDFSLRP
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
15.8 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Size

20ug, 100ug, 1mg(1mg*1 or 500ug*2)


Image




 Cusabio 다른 제품들도 함께 만나보세요!


 

설명: kit

   Kit