![](https://www.morebio.co.kr/uploaded/webedit/2407/2e171eb5aee83b44ce47cca4bf4441148523c550.png)
CUSABIO는 암, 세포 생물학, 면역학, 신경과학, 후생유전학 등 연구 분야의 글로벌 고객에게 60,000개 이상의 검증된 항체,
10,000개 이상의 재조합 단백질, 660개 이상의 사이토카인 및 수천 개의 ELISA 키트를 제공하는 검증된 제조업체 입니다.
제품 설명
Recombinant Apium graveolens Major allergen Api g 1, isoallergen 2
제품 번호
CSB-EP310896DNLa0
제품 특징
Product Details
Purity
Greater than 85% as determined by SDS-PAGE.
Alternative Names
Major allergen Api g 1; isoallergen 2; Allergen Api g 1.0201; allergen Api g 1
Species
Apium graveolens (Celery)
Target Protein Sequence
MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLGEATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNEFVVVPTDGGCIVKNTTIYNTKGDAVLPEDKIKEATEKSALAFKAVEAYLLANLQFLA
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Size
20ug, 100ug, 1mg(1mg*1 or 500ug*2)
Image
![](/uploaded/webedit/2408/8fc77029dc09b65662755b89c57d01690c61cb36.jpg)
Cusabio의 다른 제품들도 함께 만나보세요!