Proteogenix는 Primary Antibody Biosimilar - Research Grade
제품을 전문적으로 생산하는 20년의 경험이 있는 High Quality 제조사입니다.
제품 설명
제품 번호
PX-P1123
제품 특징
| Product name | Marinobacter MARHY0478 Recombinant Protein |
|---|---|
| Uniprot ID | H8WEC1 |
| Uniprot link | http://www.uniprot.org/uniprot/H8WEC1 |
| Origin species | Marinobacter |
| Expression system | Prokaryotic expression |
| Sequence | MAHNHRHKHKLMGNLGTSYGVMPVDVATAQSLSMFNEQVSATYYNPAALTKDPRGELTAGILHSEQELRSDNPNASGDIV SDSPSQHVLIGMKTNLGSLTRFGHPIYLGFIAGVEKYGKEMLAFSSETSESGQFLQYGKEPLFLNIGGATPIWRGISAGA SVRVTLEATANLDAVSTLGGETSRERLAVNAEPSLKTILGTNIDLGSTFCPESDCFLNGWETALTYRTKSSASTTVDSNI IVTQTIPDPGLSLAVTTIDSFQPETIAIGTQYSGDGWRIGGSIEQQNWSELEDEFSGDSIKDQGSVASGNRIGFDDILIP RLGAEYQLNKNFAVRGGVAYEESPLKTTRNPELNYLDTDKLVVGLGISATYDRTRLLAYPVRLDLGYQYQQLQERDFTVV DYDGDETSVTADGDIHVFSGSITLKF |
| Molecular weight | 46,10 kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 90% |
| Buffer | PBS pH 7.4 with imidazole 250mM and Urea 4M |
| Form | liquid |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 10-25 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Applications | ELISA,WB |
| Fragment Type | Partial |
| Protein Accession | H8WEC1 |
| Spec:Entrez GeneID | 12921111 |
| Spec:SwissProtID | H8WEC1 |
| NCBI Reference | H8WEC1 |
| Aliases /Synonyms | MARHY0478, long-chain fatty acid transporter, Putative hydrophobic compounds transporter |
| Reference | PX-P1123 |
| Note | For research use only |
Immunodominant protein p72 from Mycoplasma mycoides subsp. mycoides SC is a member of the mycoplasma p72 lipoprotein family. It has been shown to be a surface-exposed lipoprotein of Mycoplasma mycoides subsp. mycoides SC. The protein may play an essential role in virulence.
Publications
1: Grimaud R, Ghiglione JF, Cagnon C, Lauga B, Vaysse PJ, Rodriguez-Blanco A, Mangenot S, Cruveiller S, Barbe V, Duran R, Wu LF, Talla E, Bonin P, Michotey V. Genome sequence of the marine bacterium Marinobacter hydrocarbonoclasticus SP17, which forms biofilms on hydrophobic organic compounds. J Bacteriol. 2012 Jul;194(13):3539-40. doi: 10.1128/JB.00500-12. PubMed PMID: 22689231; PubMed Central PMCID: PMC3434751.
ProteoGenix의 모든 제품들을 만나보세요!
Proteogenix - Exclusive Distributor in South Korea "Morebio" 한국 독점 대리점 "모아바이오"