
Proteogenix는 Primary Antibody Biosimilar - Research Grade
제품을 전문적으로 생산하는 20년의 경험이 있는 High Quality 제조사입니다.
제품 설명
CD20 Protein – Human CD20 Recombinant Protein
제품 번호
PX-P3060
제품 특징
| Product name | CD20 Protein - Human CD20 Recombinant Protein |
|---|
| Uniprot ID | P11836 |
|---|
| Uniprot link | http://www.uniprot.org/uniprot/P11836 |
|---|
| Origin species | Homo sapiens (Human) |
|---|
| Expression system | Eukaryotic expression |
|---|
| Sequence | MGSHHHHHHSGENEWKRTCSRPKSNIVLLSAEEKKEQTIEIKEEVVGLTETSSQPKNEEDIEIIPIQEEEEEETETNFPE PPQDQESSPIENDSSP |
|---|
| Molecular weight | 10.98 kDa |
|---|
| Protein delivered with Tag? | N-terminal His Tag |
|---|
| Purity estimated | 90% |
|---|
| Buffer | PBS,pH 7.5 |
|---|
| Form | Frozen |
|---|
| Delivery condition | Dry Ice |
|---|
| Delivery lead time in business days | 5-7 |
|---|
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
|---|
| Brand | ProteoGenix |
|---|
| Host species | Mammalian cells |
|---|
| Applications | ELISA,WB |
|---|
| Fragment Type | Glu213-Pro297 |
|---|
| NCBI Reference | P11836 |
|---|
| Aliases /Synonyms | B-lymphocyte antigen CD20, B-lymphocyte surface antigen B1, Bp35, Leukocyte surface antigen Leu-16, Membrane-spanning 4-domains subfamily A member 1, CD_antigen: CD20, MS4A1 |
|---|
| Reference | PX-P3060 |
|---|
| Note | For research use only |
|---|
Description of CD20 Protein - Human CD20 Recombinant Protein
General information on CD20 :
Cd20 protein is a 33-37 kDa polypeptide encoded by the MS4A1 gene in humans. The protein has three transmembrane hydrophobic regions. The 85 amino acid carboxyl terminal regions of the protein is located within the cytoplasm. The length of this region in particular contrasts with the structure of other B-cell specific structures such as IgM, IgD, IgG heavy chains. Due to its multiple membrane spanning, the protein structure of CD20 resembles to that of an ion channel. There are multiple forms of CD20 proteins which derive from different CD20 phosphorylation patterns. The human CD20 protein has four transmembrane protein and is not glycosylated. The protein has no known major sequence homology to other proteins.
The precised physiological role of the proteins remains unknown, however, it has been shown that the protein is involved in the regulation of B-cell activation, proliferation and differentiation. The CD20 protein is expressed on the surface of B-cells. CD20 protein has no known ligand. However, its function is to unable B-cell immune response, particularly against T-independent ligands. Their expression is upmodulated upon B-cell activation.
The protein is also expressed at the surface germinal center cells and mantel cells of the lymph node. CD20 is also dimly expressed by a subset of T lymphocytes displaying CD8+, CD28+, CD38+, CD45RO+, TCR+, HLA-DR-phenotype which has been described in bone marrow and peripheral blood.
CD20 protein is also present in follicular dendric cells.
CD20 has been reported to be linked to:
• Neoplastic diseases of B cell precursor
• Neoplastic diseases of T cell precursor
• Acute Leukemias
• Neoplastic diseases of mature B cells
• Neoplastic diseases of mature T and NK cells
QC & Validation Data
SDS-PAGE for CD20 Protein - Human CD20 Recombinant Protein
CD20 Protein - Human CD20 Recombinant Protein, on SDS-PAGE under reducing
Publications
- 1: Meissner JM, Toporkiewicz M, Czogalla A, Matusewicz L, Kuliczkowski K, Sikorski AF. Novel antisense therapeutics delivery systems: In vitro and in vivo studies of liposomes targeted with anti-CD20 antibody. J Control Release. 2015 Dec 28;220(Pt A):515-28. doi: 10.1016/j.jconrel.2015.11.015. Epub 2015 Nov 14. PubMed PMID: 26585505.
- 2: Li J, Zhao S, Wang J, Chen J, Wen W, Zhang Q. CD20-negative diffuse large B cell lymphoma: a comprehensive analysis of 695 cases. Tumour Biol. 2016 Mar;37(3):3619-37. doi: 10.1007/s13277-015-4205-5. Epub 2015 Oct 12. Review. PubMed PMID: 26459310.
- 3: Salva KA, Bennett D, Longley J, Guitart J, Wood GS. Multispectral Imaging Approach to the Diagnosis of a CD20+ Cutaneous T-cell Lymphoproliferative Disorder: A Case Report. Am J Dermatopathol. 2015 Oct;37(10):e116-21. doi: 10.1097/DAD.0000000000000323. PubMed PMID: 26381030; PubMed Central PMCID: PMC4576727.
- 4: Gu L, Hong L, Ling Z, Feng J, Zheng Z, Du L, Mou H, Sun W, Kong X, Ling Y, Jiang Z, Zhu C, Mao W, Qian L. Establishment and Characterization of a CD20-Positive NK/T-Cell Lymphoma Cell Line. Clin Lab. 2015;61(7):731-9. PubMed PMID: 26299072.
- 5: Degheidy H, Abbasi F, Mostowski H, Gaigalas AK, Marti G, Bauer S, Wang L. Consistent, multi-instrument single tube quantification of CD20 in antibody bound per cell based on CD4 reference. Cytometry B Clin Cytom. 2016 Mar;90(2):159-67. doi: 10.1002/cyto.b.21253. Epub 2015 Jul 6. PubMed PMID: 26013593.
- 6: Vauchy C, Gamonet C, Ferrand C, Daguindau E, Galaine J, Beziaud L, Chauchet A, Henry Dunand CJ, Deschamps M, Rohrlich PS, Borg C, Adotevi O, Godet Y. CD20 alternative splicing isoform generates immunogenic CD4 helper T epitopes. Int J Cancer. 2015 Jul 1;137(1):116-26. doi: 10.1002/ijc.29366. Epub 2014 Dec 12. PubMed PMID: 25449106.
- 7: Khedmat H, Ghamar-Chehreh ME, Amini M. Significance of CD20 expression by lymphoproliferative lesions developing after liver transplantation: post-transplant lymphoproliferative disorders international survey. Saudi J Kidney Dis Transpl. 2014 Nov;25(6):1293-300. Review. PubMed PMID: 25394454.
- 8: Palanichamy A, Jahn S, Nickles D, Derstine M, Abounasr A, Hauser SL, Baranzini SE, Leppert D, von Büdingen HC. Rituximab efficiently depletes increased CD20-expressing T cells in multiple sclerosis patients. J Immunol. 2014 Jul 15;193(2):580-6. doi: 10.4049/jimmunol.1400118. Epub 2014 Jun 13. PubMed PMID: 24928997; PubMed Central PMCID: PMC4082756.
- 9: Zhang LN, Wang L, Fang C, Zou ZJ, Fan L, Zhang R, Young KH, Li JY, Xu W. The significance of single nucleotide polymorphism rs2070770 in CD20 gene in Chinese patients with diffuse large B-cell lymphoma. Leuk Lymphoma. 2015 Mar;56(3):676-81. doi: 10.3109/10428194.2014.927455. Epub 2014 Jul 17. PubMed PMID: 24898664.
- 10: Harms KL, Harms PW, Anderson T, Betz BL, Ross CW, Fullen DR, Hristov AC. Mycosis fungoides with CD20 expression: report of two cases and review of the literature. J Cutan Pathol. 2014 Jun;41(6):494-503. doi: 10.1111/cup.12299. Epub 2014 Feb 26. Review. PubMed PMID: 24467775.
- 11: Liu J, Gu Z, Yang Y, Wendlandt E, Xu H. A subset of CD20(+) MM patients without the t(11;14) are associated with poor prognosis and a link to aberrant expression of Wnt signaling. Hematol Oncol. 2014 Dec;32(4):215-7. doi: 10.1002/hon.2120. Epub 2014 Jan 9. PubMed PMID: 24408089; PubMed Central PMCID: PMC4449615.
- 12: Batran SE, Salih MM, Elhassan EM, Mohmmed AA, Adam I. CD20, CD3, placental malaria infections and low birth weight in an area of unstable malaria transmission in Central Sudan. Diagn Pathol. 2013 Nov 18;8:189. doi: 10.1186/1746-1596-8-189. PubMed PMID: 24245949; PubMed Central PMCID: PMC3937234.
- 13: Jullié ML, Carlotti M, Vivot A Jr, Beylot-Barry M, Ortonne N, Frouin E, Carlotti A, de Muret A, Balme B, Franck F, Merlio JP, Vergier B. CD20 antigen may be expressed by reactive or lymphomatous cells of transformed mycosis fungoides: diagnostic and prognostic impact. Am J Surg Pathol. 2013 Dec;37(12):1845-54. doi: 10.1097/PAS.0000000000000091. PubMed PMID: 24145652.
- 14: Fang C, Zhuang Y, Wang L, Fan L, Wu YJ, Zhang R, Zou ZJ, Zhang LN, Yang S, Xu W, Li JY. High levels of CD20 expression predict good prognosis in chronic lymphocytic leukemia. Cancer Sci. 2013 Aug;104(8):996-1001. doi: 10.1111/cas.12192. Epub 2013 Jun 7. PubMed PMID: 23659384.
- 15: Jiqiu W, Jinsong C, Dongrui C, Mingchao Z, Shuming J, Zhi-Hong L. CD20+ B-cell infiltration is related to the time after transplant and poor prognosis of acute cellular rejection in renal transplant. Exp Clin Transplant. 2013 Oct;11(5):412-7. doi: 10.6002/ect.2012.0143. Epub 2013 Feb 21. PubMed PMID: 23428174.
- 16: Jiang QP, Liu SY, Yang YX, Tan XX, Peng J, Xiong ZT, Li Z. CD20-positive NK/T-cell lymphoma with indolent clinical course: report of case and review of literature. Diagn Pathol. 2012 Oct 2;7:133. doi: 10.1186/1746-1596-7-133. Review. PubMed PMID: 23031227; PubMed Central PMCID: PMC3502398.
ProteoGenix의 모든 제품들을 만나보세요!
Proteogenix - Exclusive Distributor in South Korea "Morebio" 한국 독점 대리점 "모아바이오"