
Proteogenix는 Primary Antibody Biosimilar - Research Grade
제품을 전문적으로 생산하는 20년의 경험이 있는 High Quality 제조사입니다.
제품 설명
Human B-Gal Recombinant Protein
제품 번호
PX-P2051
제품 특징
| Product name | Human B-Gal Recombinant Protein |
|---|
| Uniprot ID | P16278 |
|---|
| Uniprot link | http://www.uniprot.org/uniprot/P16278 |
|---|
| Origin species | Homo sapiens (Human) |
|---|
| Expression system | Eukaryotic expression |
|---|
| Sequence | MLRNATQRMFEIDYSRDSFLKDGQPFRYISGSIHYSRVPRFYWKDRLLKMKMAGLNAIQTYVPWNFHEPWPGQYQFSEDHDVEYFLRLAHELGLLVILRPGPYICAEWEMGGLPAWLLEKESILLRSSDPDYLAAVDKWLGVLLPKMKPLLYQNGGPVITVQVENEYGSYFACDFDYLRFLQKRFRHHLGDDVVLFTTDGAHKTFLKCGALQGLYTTVDFGTGSNITDAFLSQRKCEPKGPLINSEFYTGWLDHW |
|---|
| Molecular weight | 74.66KDa |
|---|
| Purity estimated | 70% |
|---|
| Buffer | PBS, pH 7.5 |
|---|
| Form | Frozen |
|---|
| Delivery condition | Dry Ice |
|---|
| Delivery lead time in business days | 10-25 |
|---|
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
|---|
| Brand | ProteoGenix |
|---|
| Host species | Mammalian cells |
|---|
| Fragment Type | Partial |
|---|
| Protein Accession | AAA51819.1 |
|---|
| Spec:Entrez GeneID | 2720 |
|---|
| Spec:NCBI Gene Aliases | ELNR1, EBP, MPS4B |
|---|
| Spec:SwissProtID | P16278 |
|---|
| NCBI Reference | AAA51819.1 |
|---|
| Aliases /Synonyms | B-Gal, galactosidase, beta 1, beta-D-galactosidase precursor, Beta-galactosidase, GLB1, ELNR1, Acid beta-galactosidase, Lactase, Elastin receptor 1 |
|---|
| Reference | PX-P2051 |
|---|
| Note | For research use only |
|---|
Publications
- 1: Gao SG, Zeng C, Li LJ, Luo W, Zhang FJ, Tian J, Cheng C, Tu M, Xiong YL, Jiang W, Xu M, Lei GH. Correlation between senescence-associated beta-galactosidase expression in articular cartilage and disease severity of patients with knee osteoarthritis. Int J Rheum Dis. 2016 Mar;19(3):226-32. doi: 10.1111/1756-185X.12096. Epub 2013 Jun 3. PubMed PMID: 26112901.
- 2: Bidchol AM, Dalal A, Trivedi R, Shukla A, Nampoothiri S, Sankar VH, Danda S, Gupta N, Kabra M, Hebbar SA, Bhat RY, Matta D, Ekbote AV, Puri RD, Phadke SR, Gowrishankar K, Aggarwal S, Ranganath P, Sharda S, Kamate M, Datar CA, Bhat K, Kamath N, Shah H, Krishna S, Gopinath PM, Verma IC, Nagarajaram HA, Satyamoorthy K, Girisha KM. Recurrent and novel GLB1 mutations in India. Gene. 2015 Aug 10;567(2):173-81. doi: 10.1016/j.gene.2015.04.078. Epub 2015 Apr 30. PubMed PMID: 25936995.
- 3: Regier DS, Tifft CJ. GLB1-Related Disorders. 2013 Oct 17. In: Pagon RA, Adam MP, Ardinger HH, Wallace SE, Amemiya A, Bean LJH, Bird TD, Ledbetter N, Mefford HC, Smith RJH, Stephens K, editors. GeneReviews® [Internet]. Seattle (WA): University of Washington, Seattle; 1993-2017. Available from http://www.ncbi.nlm.nih.gov/books/NBK164500/ PubMed PMID: 24156116.
- 4: Waszkiewicz N, Szajda SD, Waszkiewicz M, Wojtulewska-Supron A, Szulc A, Kępka A, Chojnowska S, Dadan J, Ładny JR, Zwierz K, Zalewska-Szajda B. The activity of serum beta-galactosidase in colon cancer patients with a history of alcohol and nicotine dependence: preliminary data. Postepy Hig Med Dosw (Online). 2013 Aug 26;67:896-900. PubMed PMID: 24018455.
- 5: Alexandraki KI, Munayem Khan M, Chahal HS, Dalantaeva NS, Trivellin G, Berney DM, Caron P, Popovic V, Pfeifer M, Jordan S, Korbonits M, Grossman AB. Oncogene-induced senescence in pituitary adenomas and carcinomas. Hormones (Athens). 2012 Jul-Sep;11(3):297-307. PubMed PMID: 22908062.
- 6: Celtikçi B, Aydın Hİ, Sivri S, Sönmez M, Topçu M, Ozkara HA. Four novel mutations in the β-galactosidase gene identified in infantile type of GM1 gangliosidosis. Clin Biochem. 2012 May;45(7-8):571-4. doi: 10.1016/j.clinbiochem.2011.12.019. Epub 2012 Jan 3. PubMed PMID: 22234367.
- 7: Skeie JM, Hernandez J, Hinek A, Mullins RF. Molecular responses of choroidal endothelial cells to elastin derived peptides through the elastin-binding protein (GLB1). Matrix Biol. 2012 Mar;31(2):113-9. doi: 10.1016/j.matbio.2011.11.003. Epub 2011 Dec 2. PubMed PMID: 22178079; PubMed Central PMCID: PMC3288713.
- 8: Ohto U, Usui K, Ochi T, Yuki K, Satow Y, Shimizu T. Crystal structure of human β-galactosidase: structural basis of Gm1 gangliosidosis and morquio B diseases. J Biol Chem. 2012 Jan 13;287(3):1801-12. doi: 10.1074/jbc.M111.293795. Epub 2011 Nov 28. PubMed PMID: 22128166; PubMed Central PMCID: PMC3265862.
- 9: Fantur KM, Wrodnigg TM, Stütz AE, Pabst BM, Paschke E. Fluorous iminoalditols act as effective pharmacological chaperones against gene products from GLB₁ alleles causing GM1-gangliosidosis and Morquio B disease. J Inherit Metab Dis. 2012 May;35(3):495-503. doi: 10.1007/s10545-011-9409-2. Epub 2011 Oct 28. PubMed PMID: 22033734.
- 10: Murphy BA, Bunda S, Mitts T, Hinek A. The hyperthermia-enhanced association between tropoelastin and its 67-kDa chaperone results in better deposition of elastic fibers. J Biol Chem. 2010 Dec 17;285(51):40282-93. doi: 10.1074/jbc.M110.169656. Epub 2010 Oct 13. PubMed PMID: 20947500; PubMed Central PMCID: PMC3001008.
- 11: Yang CF, Wu JY, Tsai FJ. Three novel beta-galactosidase gene mutations in Han Chinese patients with GM1 gangliosidosis are correlated with disease severity. J Biomed Sci. 2010 Sep 30;17:79. doi: 10.1186/1423-0127-17-79. PubMed PMID: 20920281; PubMed Central PMCID: PMC2959015.
- 12: Li L, Higaki K, Ninomiya H, Luan Z, Iida M, Ogawa S, Suzuki Y, Ohno K, Nanba E. Chemical chaperone therapy: luciferase assay for screening of β-galactosidase mutations. Mol Genet Metab. 2010 Dec;101(4):364-9. doi: 10.1016/j.ymgme.2010.08.012. Epub 2010 Aug 18. PubMed PMID: 20826101.
- 13: Hofer D, Paul K, Fantur K, Beck M, Roubergue A, Vellodi A, Poorthuis BJ, Michelakakis H, Plecko B, Paschke E. Phenotype determining alleles in GM1 gangliosidosis patients bearing novel GLB1 mutations. Clin Genet. 2010 Sep;78(3):236-46. doi: 10.1111/j.1399-0004.2010.01379.x. Epub 2010 Feb 11. PubMed PMID: 20175788.
- 14: Antonicelli F, Bellon G, Lorimier S, Hornebeck W. Role of the elastin receptor complex (S-Gal/Cath-A/Neu-1) in skin repair and regeneration. Wound Repair Regen. 2009 Sep-Oct;17(5):631-8. doi: 10.1111/j.1524-475X.2009.00525.x. PubMed PMID: 19769716.
- 15: Hofer D, Paul K, Fantur K, Beck M, Bürger F, Caillaud C, Fumic K, Ledvinova J, Lugowska A, Michelakakis H, Radeva B, Ramaswami U, Plecko B, Paschke E. GM1 gangliosidosis and Morquio B disease: expression analysis of missense mutations affecting the catalytic site of acid beta-galactosidase. Hum Mutat. 2009 Aug;30(8):1214-21. doi: 10.1002/humu.21031. PubMed PMID: 19472408.
- 16: Mayer FQ, Pereira Fdos S, Fensom AH, Slade C, Matte U, Giugliani R. New GLB1 mutation in siblings with Morquio type B disease presenting with mental regression. Mol Genet Metab. 2009 Mar;96(3):148. doi: 10.1016/j.ymgme.2008.11.159. Epub 2008 Dec 16. PubMed PMID: 19091613.
ProteoGenix의 모든 제품들을 만나보세요!
Proteogenix - Exclusive Distributor in South Korea "Morebio" 한국 독점 대리점 "모아바이오"