본문 바로가기 주메뉴 바로가기

제품소개

제품상세페이지

Cusabio

[Cusabio] Recombinant Human Tumor necrosis factor ligand superfamily member 15(TNFSF15) (Active)

Cat-No. CSB-MP023992HU(F2)


CUSABIO는 암, 세포 생물학, 면역학, 신경과학, 후생유전학 등 연구 분야의 글로벌 고객에게 60,000개 이상의 검증된 항체, 

10,000개 이상의 재조합 단백질, 660개 이상의 사이토카인 및 수천 개의 ELISA 키트를 제공하는 검증된 제조업체 입니다. 




제품 설명


Recombinant Human Tumor necrosis factor ligand superfamily member 15(TNFSF15) (Active)




제품 번호


CSB-MP023992HU(F2)




제품 특징


Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human TNFSF15 at 2 μg/mL can bind Anti-TNFSF15 recombinant antibody(CSB-RA023992MA1HU). The EC50 is 0.8389-0.9731 ng/mL.
Target Names
Uniprot No.
Alternative Names
TL1, VEGI
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
1-192aa
Target Protein Sequence
MQLTKGRLHFSHPLSHTKHISPFVTDAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Mol. Weight
24.6 kDa
Protein Length
Full Length of Isoform 2
Tag Info
N-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

TNFSF15 functions as a death domain-containing receptor ligand implicated in endothelial cell apoptosis and tumor angiogenesis suppression, making it a target of interest in cancer biology and vascular remodeling studies. This full-length isoform 2 construct (aa 1–192) demonstrates specific receptor engagement in a functional ELISA, binding an anti-TNFSF15 recombinant antibody with an EC50 of 0.84–0.97 ng/mL, confirming that the folded ectodomain retains native epitope presentation suitable for antibody development, validation panels, and receptor-binding competition assays...Read more


Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here








Cusabio의 모든 제품을 만나보세요!


 

설명: kit

   Kit

 

설명: Protein

   Protein

 

설명: Antibody

   Hot Categories

 

설명: Molecular Biology Product

   Molecular Biology Product

 

설명: Antibody

   Antibody

설명: Small Molecule

   Small Molecule



CUSABIO - Official Distributor in South Korea "Morebio" 한국 공식 대리점 "모아바이오"